Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
R01 Count 1
Funding $151,392
PubMed Score 5.41
PubTator Score 86.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 2.095 0.000
Breast cancer 3.200 0.044
adult high grade glioma -1.600 0.001
spina bifida 1.008 0.044
ovarian cancer 1.400 0.001

Synonym

Accession Q86Y37 Q5XPL7 Q8IY11 Q8N7S4
Symbols CAC1
C10orf46

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (9)

PMID Text
26314198 silencing CACUL1 resulted in the same effects of miR-106a* overexpression in esophageal carcinoma cells, including suppressed esophageal carcinoma cell proliferation and blocked G1/S transition through CDK2 pathway by inhibiting cell cycle regulators.
24004834 H. pylori-triggered CACUL1 production occurred in an activating protein 1-dependent manner and regulated matrix metalloproteinase 9 and Slug expression to affect the invasion and metastasis of tumor cells.
23806693 CAC1 promoted the proliferation of human lung cancer A549 cells with activation of ERK1/2 signaling pathways.
23311997 High CAC1 expression is associated with cisplatin resistance in gastric cancer.
23178685 Data suggest that CAC1, in association with LSD1 (lysine-specific histone demethylase 1), functions as a corepressor of estrogen receptor alpha and may be involved in drug resistance in breast cancer.
22982681 CAC1 is a novel corepressor of RARalpha that cooperates with HDACs and is involved in the regulation of RA-induced cellular differentiation.
22903020 miR-199a-5p can regulate CAC1 and function as a tumor suppressor in colorectal cancer.
22415352 CAC1 is an important factor for the protection of cells against amyloid beta toxicity and oxidative stress in Alzheimer's disease.
19829063 CAC1 is a novel cell cycle associated protein capable of promoting cell proliferation.

AA Sequence

MEESMEEEEGGSYEAMMDDQNHNNWEAAVDGFRQPLPPPPPPSSIPAPAREPPGGQLLAVPAVSVDRKGP      1 - 70
KEGLPMGPQPPPEANGVIMMLKSCDAAAAVAKAAPAPTASSTININTSTSKFLMNVITIEDYKSTYWPKL     71 - 140
DGAIDQLLTQSPGDYIPISYEQIYSCVYKCVCQQHSEQMYSDLIKKITNHLERVSKELQASPPDLYIERF    141 - 210
NIALGQYMGALQSIVPLFIYMNKFYIETKLNRDLKDDLIKLFTEHVAEKHIYSLMPLLLEAQSTPFQVTP    211 - 280
STMANIVKGLYTLRPEWVQMAPTLFSKFIPNILPPAVESELSEYAAQDQKFQRELIQNGFTRGDQSRKRA    281 - 350
GDELAYNSSSACASSRGYR                                                       351 - 369
//

Text Mined References (13)

PMID Year Title
26314198 2015 miR-106a* inhibits the proliferation of esophageal carcinoma cells by targeting CDK2-associated Cullin 1 (CACUL1).
24004834 2013 Helicobacter pylori promotes invasion and metastasis of gastric cancer cells through activation of AP-1 and up-regulation of CACUL1.
23806693 2013 CDK-associated Cullin 1 promotes cell proliferation with activation of ERK1/2 in human lung cancer A549 cells.
23311997 2013 CDK-associated Cullin 1 can promote cell proliferation and inhibit cisplatin-induced apoptosis in the AGS gastric cancer cell line.
23178685 2013 Negative regulation of ER? by a novel protein CAC1 through association with histone demethylase LSD1.
22982681 2012 CAC1 negatively regulates RAR? activity through cooperation with HDAC.
22903020 2012 The deoxycholic acid targets miRNA-dependent CAC1 gene expression in multidrug resistance of human colorectal cancer.
22415352 2012 Expression of the newly identified gene CAC1 in the hippocampus of Alzheimer's disease patients.
19829063 2009 Identification and characterization of CAC1 as a novel CDK2-associated cullin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...