Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.65
PubTator Score 86.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.8e-07
adult high grade glioma 3801 5.9e-04
ovarian cancer 8520 9.0e-04
spina bifida 1074 3.6e-02
Breast cancer 3578 4.4e-02

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.600 5.9e-04
Breast cancer 3.200 4.4e-02
osteosarcoma 2.095 2.8e-07
ovarian cancer 1.400 9.0e-04
spina bifida -1.003 3.6e-02

Synonym

Accession Q86Y37 Q5XPL7 Q8IY11 Q8N7S4
Symbols CAC1
C10orf46

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

AA Sequence

MEESMEEEEGGSYEAMMDDQNHNNWEAAVDGFRQPLPPPPPPSSIPAPAREPPGGQLLAVPAVSVDRKGP      1 - 70
KEGLPMGPQPPPEANGVIMMLKSCDAAAAVAKAAPAPTASSTININTSTSKFLMNVITIEDYKSTYWPKL     71 - 140
DGAIDQLLTQSPGDYIPISYEQIYSCVYKCVCQQHSEQMYSDLIKKITNHLERVSKELQASPPDLYIERF    141 - 210
NIALGQYMGALQSIVPLFIYMNKFYIETKLNRDLKDDLIKLFTEHVAEKHIYSLMPLLLEAQSTPFQVTP    211 - 280
STMANIVKGLYTLRPEWVQMAPTLFSKFIPNILPPAVESELSEYAAQDQKFQRELIQNGFTRGDQSRKRA    281 - 350
GDELAYNSSSACASSRGYR                                                       351 - 369
//

Text Mined References (15)

PMID Year Title