Property Summary

NCBI Gene PubMed Count 9
PubMed Score 66.07
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
18074101 Gene dosage change of BAGE2 is associated with Robertsonian Down syndrome

AA Sequence

MAAGVVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPRCIIILVLQEP      1 - 70
TAFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATARETS                                    71 - 109
//

Publication (10)

PMID Year Title
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
18074101 2008 Gene dosage change of TPTE and BAGE2 and breakpoint analysis in Robertsonian Down syndrome.
17803354 2007 The diploid genome sequence of an individual human.
16963709 2006 Mapping of the juxtacentromeric heterochromatin-euchromatin frontier of human chromosome 21.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12909339 2003 Juxtacentromeric region of human chromosome 21: a boundary between centromeric heterochromatin and euchromatic chromosome arms.
12676563 2003 BAGE genes generated by juxtacentromeric reshuffling in the Hominidae lineage are under selective pressure.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461691 2002 New BAGE (B melanoma antigen) genes mapping to the juxtacentromeric regions of human chromosomes 13 and 21 have a cancer/testis expression profile.