Property Summary

NCBI Gene PubMed Count 9
PubMed Score 72.48
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (1)

AA Sequence

MAAGVVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPRCIIILVLQEP      1 - 70
TAFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATARETS                                    71 - 109
//

Text Mined References (10)

PMID Year Title