Property Summary

NCBI Gene PubMed Count 5
PubMed Score 72.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 3.18 1.6

AA Sequence

MAAGVVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPRCIIILVLQEP      1 - 70
TPFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATAQETS                                    71 - 109
//

Text Mined References (6)

PMID Year Title