Property Summary

NCBI Gene PubMed Count 3
PubMed Score 66.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 3.17 1.6

Synonym

Accession Q86Y27
Symbols CT2.5

Gene

AA Sequence

MAAGAVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALCFIF                                 1 - 43
//

Publication (3)

PMID Year Title
12676563 2003 BAGE genes generated by juxtacentromeric reshuffling in the Hominidae lineage are under selective pressure.
12461691 2002 New BAGE (B melanoma antigen) genes mapping to the juxtacentromeric regions of human chromosomes 13 and 21 have a cancer/testis expression profile.
7895173 1995 BAGE: a new gene encoding an antigen recognized on human melanomas by cytolytic T lymphocytes.