Property Summary

NCBI Gene PubMed Count 25
Grant Count 32
R01 Count 11
Funding $5,763,770.67
PubMed Score 351.55
PubTator Score 295.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 2.550 0.000
ovarian cancer 1.100 0.000
psoriasis -1.500 0.000

Gene RIF (21)

PMID Text
26341600 NUT gene rearrangement does not seem to be relevant in primary pulmonary carcinomas or carcinoid tumours of the lung
26220994 discovered that the translocation oncoprotein BRD4-NUT protein occupies approximately 100-200 extremely broad, cell type-specific hyperacetylated domains in the genome
26001144 Authors identified eight cases of primary pulmonary NMC over 4 years and, using a NUT immunohistochemistry screen, retrospectively identified one additional case from 166 consecutive biopsies of lung carcinomas lacking glandular differentiation.
25551299 Thirty-seven (76%) malignant germ cell tumors were NUT positive but staining was usually of weak to moderate intensity and observed in a relatively small proportion of neoplastic cells.
25512383 Data support a model in which BRD4-NUT-stimulated histone hyperacetylation recruits additional BRD4 and interacting partners to support transcriptional activation, which underlies the BRD4-NUT oncogenic mechanism in NMC.
24892275 The clinical, radiographic, and histopathologic features of NUT midline carcinoma are discussed, as well as its management options.
24875858 The involvement of the NSD3 methyltransferase as a component of the NUT fusion protein oncogenic complex identifies a new potential therapeutic target.
24655834 Case Report: NUT midline carcinoma in the nasal cavity with BRD4-NUT-rearrangement.
24185123 Four cases with the expression of P16 in NUT carcinomas with no association with human papillomavirus are being described.
23701453 immunohistochemical study of 21 cases revealed a lack of nuclear expression of NUT by undifferentiated (anaplastic) thyroid carcinomas
More...

AA Sequence

MASDGASALPGPDMSMKPSAAPSPSPALPFLPPTSDPPDHPPREPPPQPIMPSVFSPDNPLMLSAFPSSL      1 - 70
LVTGDGGPCLSGAGAGKVIVKVKTEGGSAEPSQTQNFILTQTALNSTAPGTPCGGLEGPAPPFVTASNVK     71 - 140
TILPSKAVGVSQEGPPGLPPQPPPPVAQLVPIVPLEKAWPGPHGTTGEGGPVATLSKPSLGDRSKISKDV    141 - 210
YENFRQWQRYKALARRHLSQSPDTEALSCFLIPVLRSLARLKPTMTLEEGLPLAVQEWEHTSNFDRMIFY    211 - 280
EMAERFMEFEAEEMQIQNTQLMNGSQGLSPATPLKLDPLGPLASEVCQQPVYIPKKAASKTRAPRRRQRK    281 - 350
AQRPPAPEAPKEIPPEAVKEYVDIMEWLVGTHLATGESDGKQEEEGQQQEEEGMYPDPGLLSYINELCSQ    351 - 420
KVFVSKVEAVIHPQFLADLLSPEKQRDPLALIEELEQEEGLTLAQLVQKRLMALEEEEDAEAPPSFSGAQ    421 - 490
LDSSPSGSVEDEDGDGRLRPSPGLQGAGGAACLGKVSSSGKRAREVHGGQEQALDSPRGMHRDGNTLPSP    491 - 560
SSWDLQPELAAPQGTPGPLGVERRGSGKVINQVSLHQDGHLGGAGPPGHCLVADRTSEALPLCWQGGFQP    561 - 630
ESTPSLDAGLAELAPLQGQGLEKQVLGLQKGQQTGGRGVLPQGKEPLAVPWEGSSGAMWGDDRGTPMAQS    631 - 700
YDQNPSPRAAGERDDVCLSPGVWLSSEMDAVGLELPVQIEEVIESFQVEKCVTEYQEGCQGLGSRGNISL    701 - 770
GPGETLVPGDTESSVIPCGGTVAAAALEKRNYCSLPGPLRANSPPLRSKENQEQSCETVGHPSDLWAEGC    771 - 840
FPLLESGDSTLGSSKETLPPTCQGNLLIMGTEDASSLPEASQEAGSRGNSFSPLLETIEPVNILDVKDDC    841 - 910
GLQLRVSEDTCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTR    911 - 980
NAIVPRETSVSKTHRSADRAKGKEKKKKEAEEEDEELSNFAYLLASKLSLSPREHPLSPHHASGGQGSQR    981 - 1050
ASHLLPAGAKGPSKLPYPVAKSGKRALAGGPAPTEKTPHSGAQLGVPREKPLALGVVRPSQPRKRRCDSF   1051 - 1120
VTGRRKKRRRSQ                                                             1121 - 1132
//

Publication (29)

PMID Year Title
26341600 2015 NUT expression in primary lung tumours.
26220994 2015 The oncogenic BRD4-NUT chromatin regulator drives aberrant transcription within large topological domains.
26001144 2015 Primary Pulmonary NUT Midline Carcinoma: Clinical, Radiographic, and Pathologic Characterizations.
25551299 2015 NUT protein immunoreactivity in ovarian germ cell tumours.
25512383 2015 Mechanistic analysis of the role of bromodomain-containing protein 4 (BRD4) in BRD4-NUT oncoprotein-induced transcriptional activation.
25416956 2014 A proteome-scale map of the human interactome network.
24892275 Orbital Involvement by NUT Midline Carcinoma.
24875858 2014 NSD3-NUT fusion oncoprotein in NUT midline carcinoma: implications for a novel oncogenic mechanism.
24655834 2014 A rare Japanese case with a NUT midline carcinoma in the nasal cavity: a case report with immunohistochemical and genetic analyses.
24185123 2014 Expression of P16 in NUT carcinomas with no association with human papillomavirus (HPV).
More...