Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.85
PubTator Score 5.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Precancerous Conditions 80 0.0 0.0
Disease Target Count P-value
Astrocytoma, Pilocytic 3081 3.1e-06
ovarian cancer 8520 4.7e-05
interstitial cystitis 2312 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Anorexia nervosa 80 0.0 0.9

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic -1.200 3.1e-06
interstitial cystitis 1.200 1.9e-02
ovarian cancer 1.400 4.7e-05

Gene RIF (9)

AA Sequence

MGPGERAGGGGDAGKGNAAGGGGGGRSATTAGSRAVSALCLLLSVGSAAACLLLGVQAAALQGRVAALEE      1 - 70
ERELLRRAGPPGALDAWAEPHLERLLREKLDGLAKIRTAREAPSECVCPPGPPGRRGKPGRRGDPGPPGQ     71 - 140
SGRDGYPGPLGLDGKPGLPGPKGEKGAPGDFGPRGDQGQDGAAGPPGPPGPPGARGPPGDTGKDGPRGAQ    141 - 210
GPAGPKGEPGQDGEMGPKGPPGPKGEPGVPGKKGDDGTPSQPGPPGPKGEPGSMGPRGENGVDGAPGPKG    211 - 280
EPGHRGTDGAAGPRGAPGLKGEQGDTVVIDYDGRILDALKGPPGPQGPPGPPGIPGAKGELGLPGAPGID    281 - 350
GEKGPKGQKGDPGEPGPAGLKGEAGEMGLSGLPGADGLKGEKGESASDSLQESLAQLIVEPGPPGPPGPP    351 - 420
GPMGLQGIQGPKGLDGAKGEKGASGERGPSGLPGPVGPPGLIGLPGTKGEKGRPGEPGLDGFPGPRGEKG    421 - 490
DRSERGEKGERGVPGRKGVKGQKGEPGPPGLDQPCPVGPDGLPVPGCWHK                        491 - 540
//

Text Mined References (16)

PMID Year Title