Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.85
PubTator Score 5.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis 1.400 0.000
pilocytic astrocytoma -1.200 0.000
ovarian cancer 1.400 0.000

Synonym

Accession Q86Y22 Q8IVR4 Q9NT93
Symbols

Gene

Gene RIF (9)

PMID Text
21652699 data suggest that extracellular membrane-bound CAIV, but not cytosolic CAII, augments transport activity of MCT2 in a non-catalytic manner, possibly by facilitating a proton pathway other than His-88
20447926 High COL23A1 expression is associated with recurrent non-small cell lung cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)
17627939 newly synthesized collagen XXIII either is cleaved inside the Golgi/trans-Golgi network or reaches the cell surface, where it becomes protected from processing by being localized in lipid rafts.
16728390 analysis of collagen XXIII mRNA and protein
12644459 identification and cloning; a new member of the transmembrane collagen family, showing structural homology with the transmembrane collagens XIII and XXV

AA Sequence

MGPGERAGGGGDAGKGNAAGGGGGGRSATTAGSRAVSALCLLLSVGSAAACLLLGVQAAALQGRVAALEE      1 - 70
ERELLRRAGPPGALDAWAEPHLERLLREKLDGLAKIRTAREAPSECVCPPGPPGRRGKPGRRGDPGPPGQ     71 - 140
SGRDGYPGPLGLDGKPGLPGPKGEKGAPGDFGPRGDQGQDGAAGPPGPPGPPGARGPPGDTGKDGPRGAQ    141 - 210
GPAGPKGEPGQDGEMGPKGPPGPKGEPGVPGKKGDDGTPSQPGPPGPKGEPGSMGPRGENGVDGAPGPKG    211 - 280
EPGHRGTDGAAGPRGAPGLKGEQGDTVVIDYDGRILDALKGPPGPQGPPGPPGIPGAKGELGLPGAPGID    281 - 350
GEKGPKGQKGDPGEPGPAGLKGEAGEMGLSGLPGADGLKGEKGESASDSLQESLAQLIVEPGPPGPPGPP    351 - 420
GPMGLQGIQGPKGLDGAKGEKGASGERGPSGLPGPVGPPGLIGLPGTKGEKGRPGEPGLDGFPGPRGEKG    421 - 490
DRSERGEKGERGVPGRKGVKGQKGEPGPPGLDQPCPVGPDGLPVPGCWHK                        491 - 540
//

Publication (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23568457 2013 Genetic variants associated with disordered eating.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21652699 2011 Collagen XXIII, novel ligand for integrin alpha2beta1 in the epidermis.
20447926 2010 Collagen XXIII: a potential biomarker for the detection of primary and recurrent non-small cell lung cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...