Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
Funding $61,018.9
PubMed Score 1.63
PubTator Score 2.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
osteosarcoma 1.138 0.007
atypical teratoid / rhabdoid tumor -1.100 0.002
glioblastoma -1.500 0.000
lung cancer 1.900 0.000
lung carcinoma 1.600 0.000
Pick disease -1.600 0.000
ovarian cancer -1.800 0.000
chronic rhinosinusitis -1.299 0.041

Synonym

Accession Q86Y13 B3KN01 O75162 Q6P3R9 Q6PH82 Q86Y14 Q86Y15 Q86Y16 Q8IWI0 Q96RS9
Symbols UURF2
PPP1R66
hRUL138

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
18206970 By monoubiquitination of H2A at lysine 119, 2A-HUB mediates a selective repression of a specific set of chemokine genes in macrophages, critically modulating migratory responses to TLR activation.

AA Sequence

MDSLPDEFFVRHPAVEDQRKEETENKLEKSSGQLNKQENDIPTDLVPVNLLLEVKKLLNAINTLPKGVVP      1 - 70
HIKKFLQEDFSFQTMQREVAANSQNGEEIVPALTLRFLITQLEAALRNIQAGNYTAHQINIGYYLTLLFL     71 - 140
YGVALTERGKKEDYTEAENKFLVMKMMIQENEICENFMSLVYFGRGLLRCAQKRYNGGLLEFHKSLQEIG    141 - 210
DKNDHWFDIDPTEDEDLPTTFKDLLNNFIKTTESNIMKQTICSYLDCERSCEADILKNTSYKGFFQLMCS    211 - 280
KSCCVYFHKICWKKFKNLKYPGENDQSFSGKKCLKEGCTGDMVRMLQCDVPGIVKILFEVVRKDEYITIE    281 - 350
NLGASYRKLISLKITDTDIRPKISLKFNTKDEMPIFKLDYNYFYHLLHIIIISGTDIVRQIFDEAMPPPL    351 - 420
LKKELLIHKNVLESYYNHLWTNHPLGGSWHLLYPPNKELPQSKQFDLCLLLALIKHLNVFPAPKKGWNME    421 - 490
PPSSDISKSADILRLCKYRDILLSEILMNGLTESQFNSIWKKVSDILLRLGMMQEDIDKVKENPIENISL    491 - 560
DYHQLSVYLGIPVPEIIQRMLSCYQQGIALQSITGSQRIEIEELQNEEEELSPPLMEYNINVKSHPEIQF    561 - 630
AEINKDGTSIPSESSTESLKDLQEVKSKQRKKKKTKNKKNKDSKEDQVPYVVEKEEQLRKEQANPHSVSR    631 - 700
LIKDDASDVQEDSAMEDKFYSLDELHILDMIEQGSAGKVTTDYGETEKERLARQRQLYKLHYQCEDFKRQ    701 - 770
LRTVTFRWQENQMQIKKKDKIIASLNQQVAFGINKVSKLQRQIHAKDNEIKNLKEQLSMKRSQWEMEKHN    771 - 840
LESTMKTYVSKLNAETSRALTAEVYFLQCRRDFGLLHLEQTEKECLNQLARVTHMAASNLESLQLKAAVD    841 - 910
SWNAIVADVRNKIAFLRTQYNEQINKVKQGFALSTLPPVQLPPPPPSPEILMQQFLGRPLVKESFFRPIL    911 - 980
TVPQMPAVCPGVVSATGQPRAPLMTGIAWALPAPVGDAVPPSAGLRSDPSIMNWERITDRLKTAFPQQTR    981 - 1050
KELTDFLRKLKDAYGKSLSELTFDEIVCKISQFIDPKKSQSQGKSVSNVNCVSPSHSPSQPDAAQPPKPA   1051 - 1120
WRPLTSQGPATWEGASNPDEEEEEEEPCVICHENLSPENLSVLPCAHKFHAQCIRPWLMQQGTCPTCRLH   1121 - 1190
VLLPEEFPGHPSRQLPKI                                                       1191 - 1208
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
18206970 2008 Histone H2A monoubiquitination represses transcription by inhibiting RNA polymerase II transcriptional elongation.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12538761 2003 hRUL138, a novel human RNA-binding RING-H2 ubiquitin-protein ligase.
More...