Property Summary

NCBI Gene PubMed Count 39
PubMed Score 20.48
PubTator Score 23.58

Knowledge Summary

Patent (2,487)

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -2.000 2.7e-02
group 4 medulloblastoma -1.100 1.6e-02
lung cancer 1.100 3.0e-03
nasopharyngeal carcinoma 1.400 3.6e-05
oligodendroglioma -1.900 4.1e-02
osteosarcoma -1.688 1.1e-04
ovarian cancer 1.700 3.3e-05
progressive supranuclear palsy -1.400 7.7e-03
psoriasis 1.100 1.2e-07
tuberculosis -1.500 5.4e-05

Gene RIF (25)

AA Sequence

MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPL      1 - 70
FSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKK     71 - 140
STVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGH    141 - 210
NGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAP    211 - 280
SGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATK    281 - 350
QVNKAHNRLIEKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRRRQKYQESQEPLNEVNSFPQKI    351 - 420
SYTQFPNSFYEPHQDFTSPDIFKKSRSPSWYKYTSTVSTGITDLESSTGLWPTISQFTLSEETNADVYYY    421 - 490
RIIIPVLLMLVFLALFFL                                                        491 - 508
//

Text Mined References (46)

PMID Year Title