Property Summary

NCBI Gene PubMed Count 33
Grant Count 1
Funding $14,836.4
PubMed Score 17.92
PubTator Score 23.58

Knowledge Summary

Patent (2,487)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -2.000 0.027
oligodendroglioma -1.900 0.041
psoriasis 1.100 0.000
osteosarcoma -1.688 0.000
tuberculosis and treatment for 6 months -2.300 0.000
lung cancer 1.600 0.000
group 4 medulloblastoma -1.100 0.016
nasopharyngeal carcinoma 1.400 0.000
progressive supranuclear palsy -1.400 0.008
ovarian cancer 1.700 0.000

Gene

 Grant Application (1)

PDB

2V62  

  TechDev Info (1)

Gary Johnson 233 Kinome profile via MIB/MS Technology

 Collection (1)

Gene RIF (19)

PMID Text
26345874 Our data provide preliminary evidence that the VRK2 gene might play a major role in the development of SCZ in the Northwest Chinese Han population.
25755282 Findings suggest that ubiquitin-specific protease 25 (USP25) as a VRK2 substrate that acts on TRiC deubiquitination.
25079070 data may provide evidence for the effect of VRK2 on WM connectivity in patients with schizophrenia
24447338 The amplified luminescent proximity homogeneous assay (AlphaScreen) identifies the interaction of HIV-1 Gag with VRK2
24298020 VRK2 is crucial to regulate the ubiquitination-proteosomal degradation of eukaryotic chaperonin TCP-1 ring complex
23449449 Low levels of VRK2A causes an increase in mitochondrial Bax protein level, leading to an increase in the release of cytochrome C and caspase activation, detected by PARP processing.
23105117 Human VRK2 is an active kinase playing a role in regulation of cancer cell invasion through the NFAT pathway and COX-2 expression.
23102693 This study analyzed 5 genome-wide supported variants in a Han Chinese sample, and the variant rs2312147 at VRK2 showed significant association, which was confirmed in the meta-analysis combining multiple Asian and European.
23082977 Data from molecular dynamic simulations suggest that bivalent cations play key structural roles in stabilization of VRK1/VRK2; bivalent cations have no obvious effects on VRK3. These kinases are targets in search for antineoplastic agents. [REVIEW]
22949513 Generalized epilepsies implicates susceptibility genes: CHRM3 at 1q43, VRK2 at 2p16.1, ZEB2 at 2q22.3, SCN1A at 2q24.3 and PNPO at 17q21.32.
More...

AA Sequence

MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPL      1 - 70
FSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKK     71 - 140
STVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGH    141 - 210
NGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAP    211 - 280
SGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATK    281 - 350
QVNKAHNRLIEKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRRRQKYQESQEPLNEVNSFPQKI    351 - 420
SYTQFPNSFYEPHQDFTSPDIFKKSRSPSWYKYTSTVSTGITDLESSTGLWPTISQFTLSEETNADVYYY    421 - 490
RIIIPVLLMLVFLALFFL                                                        491 - 508
//

Publication (40)

PMID Year Title
26345874 2015 Association of the VRK2 gene rs3732136 polymorphism with schizophrenia in a Northwest Chinese Han population.
25755282 2015 Vaccinia-Related Kinase 2 Controls the Stability of the Eukaryotic Chaperonin TRiC/CCT by Inhibiting the Deubiquitinating Enzyme USP25.
25087078 2014 Genetic determinants of common epilepsies: a meta-analysis of genome-wide association studies.
25079070 2014 Effects of VRK2 (rs2312147) on white matter connectivity in patients with schizophrenia.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24298020 2014 Vaccinia-related kinase 2 mediates accumulation of polyglutamine aggregates via negative regulation of the chaperonin TRiC.
23483238 2013 Sensitivity of the kinase activity of human vaccinia-related kinase proteins to toxic metals.
23449449 2013 Human VRK2 modulates apoptosis by interaction with Bcl-xL and regulation of BAX gene expression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23105117 2012 Human VRK2 (vaccinia-related kinase 2) modulates tumor cell invasion by hyperactivation of NFAT1 and expression of cyclooxygenase-2.
More...