Property Summary

NCBI Gene PubMed Count 16
Grant Count 3
R01 Count 3
Funding $400,219
PubMed Score 105.96
PubTator Score 40.59

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86Y01 O60630 Q9BS04
Symbols hDx-1

Gene

PANTHER Protein Class (2)

Protein-protein Interaction (5)

Gene RIF (4)

PMID Text
26894927 Two SNPs (rs2384077 and rs10744794) in an intron of DTX1 and the linkage disequilibrium (LD) block are significantly associated with the immune response to HBV vaccination.
23395680 this study reports the identification of two new hGIP-interacting partners, DTX1 and STAU1.
12670957 It is reported that BBAP and the human family of DTX proteins (DTX1, DTX2, and DTX3) function as E3 ligases based on their capacity for self-ubiquitination.
12617994 characterization of two genes expressed in centroblasts of human tonsils: deltex (Drosophila) homolog 1 (DTX1), which is related to the Notch pathway and a new Kelch-like protein, KLHL6

AA Sequence

MSRPGHGGLMPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLV      1 - 70
PYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWL     71 - 140
DLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLTVGSIPKSQSWPVGASSGQPCSCQQCLLVNS    141 - 210
TRAASNAILASQRRKAPPAPPLPPPPPPGGPPGALAVRPSATFTGAALWAAPAAGPAEPAPPPGAPPRSP    211 - 280
GAPGGARTPGQNNLNRPGPQRTTSVSARASIPPGVPALPVKNLNGTGPVHPALAGMTGILLCAAGLPVCL    281 - 350
TRAPKPILHPPPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPPDEDCTICMERLVT    351 - 420
ASGYEGVLRHKGVRPELVGRLGRCGHMYHLLCLVAMYSNGNKDGSLQCPTCKAIYGEKTGTQPPGKMEFH    421 - 490
LIPHSLPGFPDTQTIRIVYDIPTGIQGPEHPNPGKKFTARGFPRHCYLPNNEKGRKVLRLLITAWERRLI    491 - 560
FTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGHGYPDASYLDNVLAELTAQGVSEAAAKA              561 - 620
//

Publication (17)

PMID Year Title
26894927 2016 Deltex1 Polymorphisms Are Associated with Hepatitis B Vaccination Non-Response in Southwest China.
23395680 2013 New partner proteins containing novel internal recognition motif for human glutaminase interacting protein (hGIP).
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21124883 2010 The translation initiation factor 3f (eIF3f) exhibits a deubiquitinase activity regulating Notch activation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17028573 2006 Itch/AIP4 mediates Deltex degradation through the formation of K29-linked polyubiquitin chains.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12753744 2003 Notch2 is preferentially expressed in mature B cells and indispensable for marginal zone B lineage development.
12670957 2003 The BAL-binding protein BBAP and related Deltex family members exhibit ubiquitin-protein isopeptide ligase activity.
12617994 2003 Specific over-expression of deltex and a new Kelch-like protein in human germinal center B cells.
More...