Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.59
PubTator Score 0.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.674 1.5e-06
adult high grade glioma -1.300 2.6e-03
invasive ductal carcinoma 1.200 6.9e-03
lung cancer 1.200 3.4e-02
lung carcinoma 1.200 2.0e-16
malignant mesothelioma -7.600 4.9e-10
non-small cell lung cancer 1.148 2.2e-15
osteosarcoma 1.874 1.0e-03
ovarian cancer 2.000 2.0e-06
progressive supranuclear palsy 1.100 3.7e-02
psoriasis -2.100 2.7e-04
ulcerative colitis 1.200 2.0e-05

Gene RIF (2)

AA Sequence

MSRKQNQKDSSGFIFDLQSNTVLAQGGAFENMKEKINAVRAIVPNKSNNEIILVLQHFDNCVDKTVQAFM      1 - 70
EGSASEVLKEWTVTGKKKNKKKKNKPKPAAEPSNGIPDSSKSVSIQEEQSAPSSEKGGMNGYHVNGAIND     71 - 140
TESVDSLSEGLETLSIDARELEDPESAMLDTLDRTGSMLQNGVSDFETKSLTMHSIHNSQQPRNAAKSLS    141 - 210
RPTTETQFSNMGMEDVPLATSKKLSSNIEKSVKDLQRCTVSLARYRVVVKEEMDASIKKMKQAFAELESC    211 - 280
LMDREVALLAEMDKVKAEAMEILLSRQKKAELLKKMTHVAVQMSEQQLVELRADIKHFVSERKYDEDLGR    281 - 350
VARFTCDVETLKKSIDSFGQVSHPKNSYSTRSRCSSVTSVSLSSPSDASAASSSTCASPPSLTSANKKNF    351 - 420
APGETPAAIANSSGQPYQPLREVLPGNRRGGQGYRPQGQKSNDPMNQGRHDSMGRYRNSSWYSSGSRYQS    421 - 490
APSQAPGNTIERGQTHSAGTNGTGVSMEPSPPTPSFKKGLPQRKPRTSQTEAVNS                   491 - 545
//

Text Mined References (13)

PMID Year Title