Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.52
PubTator Score 0.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.03107145127906E-23
lung carcinoma 2844 1.99077925880864E-16
malignant mesothelioma 3163 4.94498049380315E-10
ulcerative colitis 2087 1.53068961810112E-8
ovarian cancer 8492 2.03283058696682E-6
adrenocortical carcinoma 1427 3.60569679941042E-6
osteosarcoma 7933 3.17917883776277E-5
psoriasis 6685 2.74463110450888E-4
adult high grade glioma 2148 0.00261791524465286
invasive ductal carcinoma 2950 0.00694367793754726
lung cancer 4473 0.0340861996290251
progressive supranuclear palsy 674 0.0365637537955851

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -7.600 0.000
psoriasis -2.100 0.000
osteosarcoma 2.041 0.000
adrenocortical carcinoma 1.678 0.000
non-small cell lung cancer 1.210 0.000
lung cancer 1.200 0.034
adult high grade glioma -1.300 0.003
lung carcinoma 1.200 0.000
progressive supranuclear palsy 1.100 0.037
invasive ductal carcinoma 1.200 0.007
ulcerative colitis 1.600 0.000
ovarian cancer 2.000 0.000

Synonym

Accession Q86XZ4 A8K8G9 Q9H7D4 Q9H8Y7 Q9H8Z8
Symbols SCR59
P59SCR
SPATA10
Nbla00526

Gene

  Ortholog (9)

Gene RIF (2)

PMID Text
22190034 HIV-1 Rev is identified to have a physical interaction with spermatogenesis associated, serine-rich 2 (SPATS2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSRKQNQKDSSGFIFDLQSNTVLAQGGAFENMKEKINAVRAIVPNKSNNEIILVLQHFDNCVDKTVQAFM      1 - 70
EGSASEVLKEWTVTGKKKNKKKKNKPKPAAEPSNGIPDSSKSVSIQEEQSAPSSEKGGMNGYHVNGAIND     71 - 140
TESVDSLSEGLETLSIDARELEDPESAMLDTLDRTGSMLQNGVSDFETKSLTMHSIHNSQQPRNAAKSLS    141 - 210
RPTTETQFSNMGMEDVPLATSKKLSSNIEKSVKDLQRCTVSLARYRVVVKEEMDASIKKMKQAFAELESC    211 - 280
LMDREVALLAEMDKVKAEAMEILLSRQKKAELLKKMTHVAVQMSEQQLVELRADIKHFVSERKYDEDLGR    281 - 350
VARFTCDVETLKKSIDSFGQVSHPKNSYSTRSRCSSVTSVSLSSPSDASAASSSTCASPPSLTSANKKNF    351 - 420
APGETPAAIANSSGQPYQPLREVLPGNRRGGQGYRPQGQKSNDPMNQGRHDSMGRYRNSSWYSSGSRYQS    421 - 490
APSQAPGNTIERGQTHSAGTNGTGVSMEPSPPTPSFKKGLPQRKPRTSQTEAVNS                   491 - 545
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17989879 2007 Microarray analysis of bisphenol A-induced changes in gene expression in human oral epithelial cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...