Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.84
PubTator Score 6.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -3.198 0.000
atypical teratoid / rhabdoid tumor 1.100 0.001
medulloblastoma, large-cell 1.500 0.000
adult high grade glioma 1.200 0.001
Breast cancer -1.100 0.000

Gene RIF (4)

PMID Text
25555669 our results indicate that Txl-2b expression stimulates cancer cell proliferation, accelerates the cell cycle and contributes to apoptosis resistance in colon cancer and provides a potential therapeutic target for colon cancer treatment.
23311631 Thioredoxin-like protein 2 is overexpressed in colon cancer and promotes cancer cell metastasis by interaction with ran.
18753468 MMP-13 and thioredoxin-like 2 in lungs increased in patients with COPD. Thioredoxin-like 2 was primarily seen in the bronchial epithelium
12569107 This protein is characterized. It is a microtubule-binding thioredoxin expressed predominantly in the cilia of lung airway epithelium and spermatid manchette and axoneme

AA Sequence

MGSRKKEIALQVNISTQELWEEMLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADR      1 - 70
LDVLEKYRGKCEPTFLFYAGGELVAVVRGANAPLLQKTILDQLEAEKKVLAEGRERKVIKDEALSDEDEC     71 - 140
VSHGKNNGEDEDMVSSERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKA    141 - 210
GEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHG    211 - 280
SRDREDADRELALLFPSLKFSDKDTEAPQGGEAEATAGPTEALCFPEDVD                        281 - 330
//

Text Mined References (9)

PMID Year Title
25555669 2015 Thioredoxin-like protein 2b facilitates colon cancer cell proliferation and inhibits apoptosis via NF-?B pathway.
23311631 2013 Thioredoxin-like protein 2 is overexpressed in colon cancer and promotes cancer cell metastasis by interaction with ran.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
19852809 2009 Nme protein family evolutionary history, a vertebrate perspective.
18753468 2009 Proteomic analysis in lung tissue of smokers and COPD patients.
14713334 2004 The mammalian testis-specific thioredoxin system.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12569107 2003 Characterization of human thioredoxin-like 2. A novel microtubule-binding thioredoxin expressed predominantly in the cilia of lung airway epithelium and spermatid manchette and axoneme.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.