Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.84
PubTator Score 6.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Amyotrophic Lateral Sclerosis 432
Disease Target Count P-value
osteosarcoma 7933 1.68943684359118E-11
medulloblastoma, large-cell 6234 5.61050790582041E-5
Breast cancer 3099 1.31311593432074E-4
adult high grade glioma 2148 5.20242500619701E-4
atypical teratoid / rhabdoid tumor 4369 8.48599226287465E-4

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -3.198 0.000
atypical teratoid / rhabdoid tumor 1.100 0.001
medulloblastoma, large-cell 1.500 0.000
adult high grade glioma 1.200 0.001
Breast cancer -1.100 0.000

Synonym

Accession Q86XW9 Q7Z4A8 Q8N1V7
Symbols TXL2
TXL-2
TXNDC6
NM23-H9

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Rat OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid

Gene RIF (4)

PMID Text
25555669 our results indicate that Txl-2b expression stimulates cancer cell proliferation, accelerates the cell cycle and contributes to apoptosis resistance in colon cancer and provides a potential therapeutic target for colon cancer treatment.
23311631 Thioredoxin-like protein 2 is overexpressed in colon cancer and promotes cancer cell metastasis by interaction with ran.
18753468 MMP-13 and thioredoxin-like 2 in lungs increased in patients with COPD. Thioredoxin-like 2 was primarily seen in the bronchial epithelium
12569107 This protein is characterized. It is a microtubule-binding thioredoxin expressed predominantly in the cilia of lung airway epithelium and spermatid manchette and axoneme

AA Sequence

MGSRKKEIALQVNISTQELWEEMLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADR      1 - 70
LDVLEKYRGKCEPTFLFYAGGELVAVVRGANAPLLQKTILDQLEAEKKVLAEGRERKVIKDEALSDEDEC     71 - 140
VSHGKNNGEDEDMVSSERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKA    141 - 210
GEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHG    211 - 280
SRDREDADRELALLFPSLKFSDKDTEAPQGGEAEATAGPTEALCFPEDVD                        281 - 330
//

Text Mined References (9)

PMID Year Title
25555669 2015 Thioredoxin-like protein 2b facilitates colon cancer cell proliferation and inhibits apoptosis via NF-?B pathway.
23311631 2013 Thioredoxin-like protein 2 is overexpressed in colon cancer and promotes cancer cell metastasis by interaction with ran.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
19852809 2009 Nme protein family evolutionary history, a vertebrate perspective.
18753468 2009 Proteomic analysis in lung tissue of smokers and COPD patients.
14713334 2004 The mammalian testis-specific thioredoxin system.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12569107 2003 Characterization of human thioredoxin-like 2. A novel microtubule-binding thioredoxin expressed predominantly in the cilia of lung airway epithelium and spermatid manchette and axoneme.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.