Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.86
PubTator Score 6.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.200 5.2e-04
atypical teratoid / rhabdoid tumor 1.100 8.5e-04
Breast cancer -1.100 1.3e-04
medulloblastoma, large-cell 1.500 5.6e-05
osteosarcoma -3.198 1.7e-11

Synonym

Accession Q86XW9 Q7Z4A8 Q8N1V7
Symbols TXL2
TXL-2
TXNDC6
NM23-H9

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (4)

AA Sequence

MGSRKKEIALQVNISTQELWEEMLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADR      1 - 70
LDVLEKYRGKCEPTFLFYAGGELVAVVRGANAPLLQKTILDQLEAEKKVLAEGRERKVIKDEALSDEDEC     71 - 140
VSHGKNNGEDEDMVSSERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKA    141 - 210
GEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHG    211 - 280
SRDREDADRELALLFPSLKFSDKDTEAPQGGEAEATAGPTEALCFPEDVD                        281 - 330
//

Text Mined References (9)

PMID Year Title