Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.23
PubTator Score 0.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 6.39528808484978E-9
ovarian cancer 8492 1.89587411368444E-6

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis 1.600 0.000
ovarian cancer 1.700 0.000

Synonym

Accession Q86XT9 D5FK14 Q8WVV8 IGFBP-3R
Symbols IGFBP-3R

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

AA Sequence

MGNCQAGHNLHLCLAHHPPLVCATLILLLLGLSGLGLGSFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLC      1 - 70
PRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGT     71 - 140
CLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSRLLVLGS    141 - 210
FLLLFCGLLCCVTAMCFHPRRESHWSRTRL                                            211 - 240
//

Text Mined References (4)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
20353938 2010 Identification of a novel cell death receptor mediating IGFBP-3-induced anti-tumor effects in breast and prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.