Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.24
PubTator Score 0.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 6.4e-09
ovarian cancer 8520 1.9e-06
Disease Target Count Z-score Confidence
Hermansky-Pudlak syndrome 42 3.652 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.700 1.9e-06
tuberculosis 1.600 6.4e-09

AA Sequence

MGNCQAGHNLHLCLAHHPPLVCATLILLLLGLSGLGLGSFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLC      1 - 70
PRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGT     71 - 140
CLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSRLLVLGS    141 - 210
FLLLFCGLLCCVTAMCFHPRRESHWSRTRL                                            211 - 240
//

Text Mined References (4)

PMID Year Title