Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.11
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00120100416347971
pancreatic cancer 2300 0.00133925996758156
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00183257701617558
gastric carcinoma 832 0.0418490857678241
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0432859554803774
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 45 5.037 2.5

Expression

Synonym

Accession Q86XT4 Q86XT3
Symbols TRIM50A

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (3)

PMID Text
24308962 TRIM50 K372 residue competes for post-translational protein modifications such as acetylation and ubiquitination.
22792322 When the proteasome activity is impaired, TRIM50 fails to drive its substrates to the proteasome-mediated degradation.
18398435 Encodes an E3 ubiquitin ligase; putatively involved in phenotype determination of Williams-Beuren syndrome.

AA Sequence

MAWQVSLLELEDWLQCPICLEVFKEPLMLQCGHSYCKGCLVSLSCHLDAELRCPVCRQAVDGSSSLPNVS      1 - 70
LARVIEALRLPGDPEPKVCVHHRNPLSLFCEKDQELICGLCGLLGSHQHHPVTPVSTVYSRMKEELAALI     71 - 140
SELKQEQKKVDELIAKLVNNRTRIVNESDVFSWVIRREFQELHHLVDEEKARCLEGIGGHTRGLVASLDM    141 - 210
QLEQAQGTRERLAQAECVLEQFGNEDHHKFIRKFHSMASRAEMPQARPLEGAFSPISFKPGLHQADIKLT    211 - 280
VWKRLFRKVLPAPEPLKLDPATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTCVLASRGFSCGRHY    281 - 350
WEVVVGSKSDWRLGVIKGTASRKGKLNRSPEHGVWLIGLKEGRVYEAFACPRVPLPVAGHPHRIGLYLHY    351 - 420
EQGELTFFDADRPDDLRPLYTFQADFQGKLYPILDTCWHERGSNSLPMVLPPPSGPGPLSPEQPTKL       421 - 487
//

Text Mined References (10)

PMID Year Title
24308962 2014 HDAC6 mediates the acetylation of TRIM50.
22829933 2012 TRIM27 negatively regulates NOD2 by ubiquitination and proteasomal degradation.
22792322 2012 The E3-ubiquitin ligase TRIM50 interacts with HDAC6 and p62, and promotes the sequestration and clearance of ubiquitinated proteins into the aggresome.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
18398435 2008 Williams-Beuren syndrome TRIM50 encodes an E3 ubiquitin ligase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.