Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.16
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.000

Synonym

Accession Q86XT2 Q6P2C3
Symbols WBSCR24

Gene

AA Sequence

MYRARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLEREACLASNYALAKENLA      1 - 70
LRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHCALGWLQAELEEAEQEAEEQMEQLLLG     71 - 140
EQSLEAFLPAFQRGRALAHLRRTQAEKLQELLRRRERSAQPAPTSAADPPKSFPAAAVLPTGAARGPPAV    141 - 210
PRSLPPLDSRPVPPLKGSPGCPLGPAPLLSPRPSQPEPPHR                                 211 - 251
//

Publication (13)

PMID Year Title
25288136 2015 Genome-wide meta-analysis identifies six novel loci associated with habitual coffee consumption.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22405001 2012 The UBAP1 subunit of ESCRT-I interacts with ubiquitin via a SOUBA domain.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18005716 2007 Identification of human MVB12 proteins as ESCRT-I subunits that function in HIV budding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15218037 2004 The human endosomal sorting complex required for transport (ESCRT-I) and its role in HIV-1 budding.
More...