Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.16
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.6e-29
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 50 4.275 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 1.6e-29

Protein-protein Interaction (11)

AA Sequence

MYRARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLEREACLASNYALAKENLA      1 - 70
LRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHCALGWLQAELEEAEQEAEEQMEQLLLG     71 - 140
EQSLEAFLPAFQRGRALAHLRRTQAEKLQELLRRRERSAQPAPTSAADPPKSFPAAAVLPTGAARGPPAV    141 - 210
PRSLPPLDSRPVPPLKGSPGCPLGPAPLLSPRPSQPEPPHR                                 211 - 251
//

Text Mined References (13)

PMID Year Title