Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.36
PubTator Score 4.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.9e-20
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 2.9e-20

Gene RIF (2)

AA Sequence

MMSPSQASLLFLNVCIFICGEAVQGNCVHHSTDSSVVNIVEDGSNAKDESKSNDTVCKEDCEESCDVKTK      1 - 70
ITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPH     71 - 140
RPVQSHGLDCTDIKDTIGSVTKTPSGLYIIHPEGSSYPFEVMCDMDYRGGGRTVIQKRIDGIIDFQRLWC    141 - 210
DYLDGFGDLLGEFWLGLKKIFYIVNQKNTSFMLYVALESEDDTLAYASYDNFWLEDETRFFKMHLGRYSG    211 - 280
NAGDAFRGLKKEDNQNAMPFSTSDVDNDGCRPACLVNGQSVKSCSHLHNKTGWWFNECGLANLNGIHHFS    281 - 350
GKLLATGIQWGTWTKNNSPVKIKSVSMKIRRMYNPYFK                                    351 - 388
//

Text Mined References (10)

PMID Year Title