Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.36
PubTator Score 4.43

Knowledge Summary


No data available


  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,683


  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.000

Gene RIF (2)

21559522 CD34+ CD133+ hematopoietic stem cells cultured with growth factors including Angptl5 efficiently engraft adult NOD-SCID Il2rgamma-/- (NSG) mice
12624729 Maps to 11q22, mainly expressed in adult human heart.

AA Sequence

GKLLATGIQWGTWTKNNSPVKIKSVSMKIRRMYNPYFK                                    351 - 388

Publication (8)

PMID Year Title
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
21559522 2011 Human CD34+ CD133+ hematopoietic stem cells cultured with growth factors including Angptl5 efficiently engraft adult NOD-SCID Il2r?-/- (NSG) mice.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12624729 2003 Identification of a novel human angiopoietin-like gene expressed mainly in heart.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.