Property Summary

NCBI Gene PubMed Count 33
PubMed Score 11.59
PubTator Score 12.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
malignant mesothelioma 3163 6.99550786860835E-8
osteosarcoma 7933 9.02053072227873E-7
tuberculosis and treatment for 6 months 686 6.49014540007965E-5
ovarian cancer 8492 6.60793139073761E-5
psoriasis 6685 1.85747022684797E-4
primitive neuroectodermal tumor 3031 1.98243259389369E-4
lung cancer 4473 9.91723636956729E-4
group 3 medulloblastoma 2254 0.00277008269190083
posterior fossa group B ependymoma 1530 0.0031285232739751
atypical teratoid/rhabdoid tumor 1095 0.00442978514181032
Waldenstrons macroglobulinemia 765 0.00535994126357511
medulloblastoma, large-cell 6234 0.00687830378154822
pediatric high grade glioma 2712 0.0073502548911385
progressive supranuclear palsy 674 0.00774223112463445
Disease Target Count Z-score Confidence
Mitral valve stenosis 10 4.139 2.1
Mitral valve insufficiency 17 3.919 2.0

Expression

Synonym

Accession Q86XR8 A0PJH1 A8K5D0 B4DDP5 F5H5F7 Q14704 Q5JB46 Q8IXP0 Q9BVF9 Cep57
Symbols MVA2
PIG8
TSP57

Gene

PDB

4L0R  

  Ortholog (12)

Gene RIF (10)

PMID Text
26743940 Cep57 is a mitotic kinetochore component that links the function of the KMN (KNL1/Mis12 complex/Ndc80 complex) network and spindle assembly checkpoint via Mis12 binding and Mad1-Mad2 interaction.
26561035 We identified copy number variation (CNV) deletion impacting the exon sequences of CEP57L1, present in the affected mother and her affected daughter
23569207 Cep57 is essential for cytokinesis via regulation of central spindle assembly and formation of the midbody
23333316 Cep57, Cep63, and Cep152 are parts of a ring-like complex localizing around the proximal end of centrioles.
23243019 Data suggest for therapeutic targeting of the FGF-2/FGFR1/CEP57 axis in prostate cancer.
22508265 Cep57 acts as a PCM component through binding to NEDD1 and is required for spindle microtubule organization and maintenance of spindle pole integrity.
22190034 HIV-1 Vpu is identified to have a physical interaction with centrosomal protein 57kDa (CEP57) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21552266 Our findings indicate that these and/or additional functions of CEP57 are crucial for maintaining correct chromosomal number during cell division.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIF      1 - 70
SALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKC     71 - 140
NLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKM    141 - 210
QELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQP    211 - 280
HYRLCLGDMPFVAGKSTSPSHAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTP    281 - 350
PSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRK    351 - 420
YQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNS    421 - 490
LQSSSLCWDY                                                                491 - 500
//

Text Mined References (37)

PMID Year Title
26743940 2016 Cep57 is a Mis12-interacting kinetochore protein involved in kinetochore targeting of Mad1-Mad2.
26561035 2015 Copy number variation in CEP57L1 predisposes to congenital absence of bilateral ACL and PCL ligaments.
25416956 2014 A proteome-scale map of the human interactome network.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23569207 2013 Cep57 protein is required for cytokinesis by facilitating central spindle microtubule organization.
23333316 2013 Selective chemical crosslinking reveals a Cep57-Cep63-Cep152 centrosomal complex.
23243019 2013 FGF-2 disrupts mitotic stability in prostate cancer through the intracellular trafficking protein CEP57.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22508265 2012 Cep57, a NEDD1-binding pericentriolar material component, is essential for spindle pole integrity.
22321063 2012 Nuclear import of exogenous FGF1 requires the ER-protein LRRC59 and the importins Kpn?1 and Kpn?1.
More...