Property Summary

NCBI Gene PubMed Count 33
PubMed Score 11.75
PubTator Score 12.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
MOSAIC VARIEGATED ANEUPLOIDY SYNDROME 5 0.0 0.0
Disease Target Count Z-score Confidence
Mitral valve stenosis 14 4.001 2.0
Mitral valve insufficiency 49 3.753 1.9

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 4.4e-03
group 3 medulloblastoma 1.700 2.8e-03
lung cancer 1.700 9.9e-04
malignant mesothelioma 1.300 1.8e-05
medulloblastoma, large-cell 1.100 6.9e-03
osteosarcoma -1.700 7.5e-05
ovarian cancer -1.100 2.8e-03
pediatric high grade glioma 1.100 7.4e-03
posterior fossa group B ependymoma 1.100 3.1e-03
primitive neuroectodermal tumor 1.300 7.5e-03
progressive supranuclear palsy -1.100 7.7e-03
psoriasis -1.200 6.4e-04
tuberculosis and treatment for 6 months -1.200 6.5e-05
Waldenstrons macroglobulinemia 1.304 5.4e-03

Gene RIF (10)

AA Sequence

MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIF      1 - 70
SALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKC     71 - 140
NLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKM    141 - 210
QELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQP    211 - 280
HYRLCLGDMPFVAGKSTSPSHAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTP    281 - 350
PSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRK    351 - 420
YQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNS    421 - 490
LQSSSLCWDY                                                                491 - 500
//

Text Mined References (37)

PMID Year Title