Property Summary

NCBI Gene PubMed Count 14
PubMed Score 151.50
PubTator Score 175.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Astrocytoma, Pilocytic 2.000 3.8e-04
Breast cancer -1.700 2.0e-11
ductal carcinoma in situ -1.500 3.8e-04
ependymoma 1.200 8.7e-03
intraductal papillary-mucinous carcinoma... -1.500 3.1e-04
intraductal papillary-mucinous neoplasm ... -1.300 6.4e-03
invasive ductal carcinoma -2.000 5.3e-04
ovarian cancer 1.400 2.6e-04
Pick disease -1.100 8.9e-03
progressive supranuclear palsy -1.600 1.3e-02
psoriasis -1.100 3.0e-59

Gene RIF (9)

AA Sequence

MLLRDLVLRRGCCWSSLLLHCALHPLWGFVQVTHGEPQKSCSKVTDSCRHVCQCRPPPPLPPPPPPPPPP      1 - 70
RLLSAPAPNSTSCPTEESWWSGLVIIIAVCCASLVFLTVLVIICYKAIKRKPLRKDENGTSVAEYPMSAS     71 - 140
QSNKGVDVNNAVV                                                             141 - 153
//

Text Mined References (15)

PMID Year Title