Property Summary

NCBI Gene PubMed Count 13
Grant Count 11
Funding $943,205.33
PubMed Score 136.58
PubTator Score 175.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (8)

PMID Text
26742039 The results suggest that aberrant methylation of rDNA and PRIMA1 is associated with the pathogenesis of Borderline Personality Disorder.
26482433 Hypermethylation of the selected markers (MAL, PRIMA1, PTGDR and SFRP1) can result in reduced gene expression and may contribute to the formation of colorectal cancer.
23545415 The autophagic potential of PRIMA-1 could be modulated in a different way by the presence of wild type or mutant p53.
22750213 By using site-directed mutagenesis, the asparagine-43 was identified to be the N-linked glycosylation site of PRiMA. Abolishing glycosylation on mouse PRiMA appeared not to affect its assembly with AChE(T).
20471375 A strong association of AChE with PRiMA at the plasma membrane is therefore a feature specific to principal cholinergic neurons that innervate the central nervous system.
20147288 PRiMA in neurons has a role in targeting acetylcholinesterase to membrane rafts
19368807 These results suggested that a MAP kinase signaling pathway served as one of the transcriptional regulators in controlling PRiMA gene expression during the neuronal differentiation process.
16429581 PRiMA-Luc promotor-driven luciferase activity was increased during cell differentiation

AA Sequence

MLLRDLVLRRGCCWSSLLLHCALHPLWGFVQVTHGEPQKSCSKVTDSCRHVCQCRPPPPLPPPPPPPPPP      1 - 70
RLLSAPAPNSTSCPTEESWWSGLVIIIAVCCASLVFLTVLVIICYKAIKRKPLRKDENGTSVAEYPMSAS     71 - 140
QSNKGVDVNNAVV                                                             141 - 153
//

Publication (14)

PMID Year Title
26742039 2016 Aberrant DNA Methylation of rDNA and PRIMA1 in Borderline Personality Disorder.
26482433 2015 DNA hypermethylation and decreased mRNA expression of MAL, PRIMA1, PTGDR and SFRP1 in colorectal adenoma and cancer.
23545415 2013 PRIMA-1 induces autophagy in cancer cells carrying mutant or wild type p53.
22754043 2012 A genome-wide association study of caffeine-related sleep disturbance: confirmation of a role for a common variant in the adenosine receptor.
22750213 2012 N-linked glycosylation of proline-rich membrane anchor (PRiMA) is not required for assembly and trafficking of globular tetrameric acetylcholinesterase.
20471375 2010 Co-localization of PRiMA with acetylcholinesterase in cholinergic neurons of rat brain: an immunocytochemical study.
20147288 2010 Targeting acetylcholinesterase to membrane rafts: a function mediated by the proline-rich membrane anchor (PRiMA) in neurons.
19368807 2009 Transcriptional regulation of proline-rich membrane anchor (PRiMA) of globular form acetylcholinesterase in neuron: an inductive effect of neuron differentiation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16489065 2006 PDLIM4 repression by hypermethylation as a potential biomarker for prostate cancer.
More...