Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.30
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 4.6e-08
nasopharyngeal carcinoma 1058 1.3e-04
tuberculosis 2010 3.1e-04
primary Sjogren syndrome 735 6.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
nasopharyngeal carcinoma -1.200 1.3e-04
osteosarcoma -2.024 4.6e-08
primary Sjogren syndrome 1.600 6.4e-03
tuberculosis 1.300 3.1e-04

Gene RIF (2)

AA Sequence

MGPDRKEVPLSRGTQAVVVGKGRGAPGDDSSMGGRPSSPLDKQQRQHLRGQVDTLLRNFLPCYRGQLAAS      1 - 70
VLRQISRELGPQEPTGSQLLRSKKLPRVREHRGPLTQLRGHPPRWQPIFCVLRGDGRLEWFSHKEEYENG     71 - 140
GHCLGSTALTGYTLLTSQREYLRLLDALCPESLGDHTQEEPDSLLEVPVSFPLFLQHPFRRHLCFSAATR    141 - 210
EAQHAWRLALQGGIRLQGIVLQRSQAPAARAFLDAVRLYRQHQGHFGDDDVTLGSDAEVLTAVLMREQLP    211 - 280
ALRAQTLPGLRGAGRARAWAWTELLDAVHAAVLAGASAGLCAFQPEKDELLASLEKTIRPDVDQLLRQRA    281 - 350
RVAGRLRTDIRGPLESCLRREVDPQLPRVVQTLLRTVEASLEAVRTLLAQGMDRLSHRLRQSPSGTRLRR    351 - 420
EVYSFGEMPWDLALMQTCYREAERSRGRLGQLAAPFGFLGMQSLVFGAQDLAQQLMADAVATFLQLADQC    421 - 490
LTTALNCDQAAQRLERVRGRVLKKFKSDSGLAQRRFIRGWGLCIFLPFVLSQLEPGCKKELPEFEGDVLA    491 - 560
VGSQALTTEGIYEDVIRGCLLQRIDQELKKTLGANDVSCTLDGCLEVPWEQEGAAPNLNLVSSFLAGRQA    561 - 630
FTDFLCLPAKSSANWILAASLLSCSCFRSGFHRDSRVFLVQLAEGLSHSLETVSSHSVWSFRPTPRQ       631 - 697
//

Text Mined References (7)

PMID Year Title