Property Summary

NCBI Gene PubMed Count 10
Grant Count 15
R01 Count 15
Funding $1,711,674.25
PubMed Score 11.97
PubTator Score 5.76

Knowledge Summary

Patent (3,300)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.527 0.000

Gene RIF (3)

PMID Text
23333304 HIV-1 Vif downregulates the expression of cation channel sperm associated 3 protein (CATSPER3) in Vif-expression T cells
12932298 Catsper3 has a single channel-forming domain, a pore-loop with the consensus sequence TxDxW, & a coiled-coil protein-protein interaction domain in the C-terminal tail. CatSpers 1,2,3 & 4 may interact directly or indirectly to form a functional tetramer.
12646162 PMID: 12646162 concludes Alu repeats interfere with splicing of DCOHM and CAVL such that transcripts containing exons of both genes exist.

AA Sequence

MSQHRHQRHSRVISSSPVDTTSVGFCPTFKKFKRNDDECRAFVKRVIMSRFFKIIMISTVTSNAFFMALW      1 - 70
TSYDIRYRLFRLLEFSEIFFVSICTSELSMKVYVDPINYWKNGYNLLDVIIIIVMFLPYALRQLMGKQFT     71 - 140
YLYIADGMQSLRILKLIGYSQGIRTLITAVGQTVYTVASVLLLLFLLMYIFAILGFCLFGSPDNGDHDNW    141 - 210
GNLAAAFFTLFSLATVDGWTDLQKQLDNREFALSRAFTIIFILLASFIFLNMFVGVMIMHTEDSIRKFER    211 - 280
ELMLEQQEMLMGEKQVILQRQQEEISRLMHIQKNADCTSFSELVENFKKTLSHTDPMVLDDFGTSLPFID    281 - 350
IYFSTLDYQDTTVHKLQELYYEIVHVLSLMLEDLPQEKPQSLEKVDEK                          351 - 398
//

Text Mined References (15)

PMID Year Title
26989199 2016 Unconventional endocannabinoid signaling governs sperm activation via the sex hormone progesterone.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
23666240 2013 Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14.
23568457 2013 Genetic variants associated with disordered eating.
23263487 2013 Genome-wide association analyses in East Asians identify new susceptibility loci for colorectal cancer.
21412339 2011 Progesterone activates the principal Ca2+ channel of human sperm.
21412338 2011 The CatSper channel mediates progesterone-induced Ca2+ influx in human sperm.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17347248 2007 Expression of CatSper family transcripts in the mouse testis during post-natal development and human ejaculated spermatozoa: relationship to sperm motility.
17227845 2007 All four CatSper ion channel proteins are required for male fertility and sperm cell hyperactivated motility.
More...