Property Summary

Ligand Count 3
NCBI Gene PubMed Count 10
PubMed Score 13.53
PubTator Score 5.76

Knowledge Summary

Patent (3,300)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.527 7.5e-07

Gene RIF (3)

AA Sequence

MSQHRHQRHSRVISSSPVDTTSVGFCPTFKKFKRNDDECRAFVKRVIMSRFFKIIMISTVTSNAFFMALW      1 - 70
TSYDIRYRLFRLLEFSEIFFVSICTSELSMKVYVDPINYWKNGYNLLDVIIIIVMFLPYALRQLMGKQFT     71 - 140
YLYIADGMQSLRILKLIGYSQGIRTLITAVGQTVYTVASVLLLLFLLMYIFAILGFCLFGSPDNGDHDNW    141 - 210
GNLAAAFFTLFSLATVDGWTDLQKQLDNREFALSRAFTIIFILLASFIFLNMFVGVMIMHTEDSIRKFER    211 - 280
ELMLEQQEMLMGEKQVILQRQQEEISRLMHIQKNADCTSFSELVENFKKTLSHTDPMVLDDFGTSLPFID    281 - 350
IYFSTLDYQDTTVHKLQELYYEIVHVLSLMLEDLPQEKPQSLEKVDEK                          351 - 398
//

Text Mined References (15)

PMID Year Title