Property Summary

NCBI Gene PubMed Count 15
Grant Count 15
Funding $1,807,486.33
PubMed Score 141.27
PubTator Score 14.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
medulloblastoma, large-cell 1.400 0.000
non-small cell lung cancer -4.994 0.000
intraductal papillary-mucinous adenoma (... 6.000 0.000
lung adenocarcinoma -3.800 0.000
lung carcinoma -4.900 0.000
ovarian cancer 1.300 0.000
psoriasis -1.300 0.006

Gene RIF (11)

PMID Text
26974160 these results reveal an antiinflammatory role for GKN2, provide in vivo evidence that links GKN2 loss to GC pathogenesis, and suggest GKN restoration as a strategy to restrain GC progression.
26070363 the gestational age-dependent and compartment-specific expression pattern of GKN2 points to a role for placental development
24460791 Epstein-Barr virus EBNA1 binds to the divergent promoter of the GKN1 and GKN2 genes and contributes to the complex transcriptional and epigenetic deregulation of the GKN1 and GKN2 tumor suppressor genes.
24408014 GKN2 could inhibit the proliferation, migration, and invasion of gastric cancer cells and might represent a novel therapeutic target for gastric cancer.
24151046 These data demonstrate that in the presence of GKN2, GKN1 loses its ability to decrease cell proliferation, induce apoptosis, and inhibit epigenetic alterations in gastric cancer cells.
21870107 gastrointestinal tract specific gene GDDR might inhibit gastric cancer growth in a TFF1 dependent manner
21151392 GKN2 was expressed in 33 non-tumoral mucosae (66%) and 35 tumoral mucosae (70%).
18722547 in gastric cancer, expression of TFF1 in the absence of TFIZ1 is associated with lymph node metastasis
18593995 GKN1 and GKN2 expression occurs frequently in gastric adenocarcinomas, especially in the diffuse subtype
17982272 The TFF1-GKN2 heterodimer and TFF2 differ characteristically by their binding to gastric mucins.
More...

AA Sequence

MKILVAFLVVLTIFGIQSHGYEVFNIISPSNNGGNVQETVTIDNEKNTAIINIHAGSCSSTTIFDYKHGY      1 - 70
IASRVLSRRACFILKMDHQNIPPLNNLQWYIYEKQALDNMFSSKYTWVKYNPLESLIKDVDWFLLGSPIE     71 - 140
KLCKHIPLYKGEVVENTHNVGAGGCAKAGLLGILGISICADIHV                              141 - 184
//

Publication (17)

PMID Year Title
26974160 2016 Loss of gastrokine-2 drives premalignant gastric inflammation and tumor progression.
26070363 2015 Trophoblast expression dynamics of the tumor suppressor gene gastrokine 2.
25270871 2014 Effects of gastrokine?2 expression on gastric cancer cell apoptosis by activation of extrinsic apoptotic pathways.
24460791 2014 EBNA1 binding and epigenetic regulation of gastrokine tumor suppressor genes in gastric carcinoma cells.
24408014 2014 Gastrokine-2 is downregulated in gastric cancer and its restoration suppresses gastric tumorigenesis and cancer metastasis.
24151046 2014 GKN2 contributes to the homeostasis of gastric mucosa by inhibiting GKN1 activity.
21870107 2012 Gastrointestinal tract specific gene GDDR inhibits the progression of gastric cancer in a TFF1 dependent manner.
21151392 2010 Detection of ?-catenin, gastrokine-2 and embryonic stem cell expressed ras in gastric cancers.
18722547 2009 The trefoil factor interacting protein TFIZ1 binds the trefoil protein TFF1 preferentially in normal gastric mucosal cells but the co-expression of these proteins is deregulated in gastric cancer.
18593995 2008 Decreased expression of gastrokine 1 and the trefoil factor interacting protein TFIZ1/GKN2 in gastric cancer: influence of tumor histology and relationship to prognosis.
More...