Property Summary

NCBI Gene PubMed Count 18
PubMed Score 155.70
PubTator Score 14.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 6.000 8.0e-06
lung adenocarcinoma -3.100 1.2e-10
lung carcinoma -4.900 3.3e-34
medulloblastoma, large-cell 1.400 4.0e-04
non-small cell lung cancer -4.994 2.5e-35
ovarian cancer 1.300 3.0e-09
psoriasis -1.300 6.4e-03

Gene RIF (14)

AA Sequence

MKILVAFLVVLTIFGIQSHGYEVFNIISPSNNGGNVQETVTIDNEKNTAIINIHAGSCSSTTIFDYKHGY      1 - 70
IASRVLSRRACFILKMDHQNIPPLNNLQWYIYEKQALDNMFSSKYTWVKYNPLESLIKDVDWFLLGSPIE     71 - 140
KLCKHIPLYKGEVVENTHNVGAGGCAKAGLLGILGISICADIHV                              141 - 184
//

Text Mined References (20)

PMID Year Title