Property Summary

NCBI Gene PubMed Count 14
PubMed Score 13.27
PubTator Score 5.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
aldosterone-producing adenoma -1.461 2.1e-02
astrocytic glioma 1.400 3.0e-02
atypical teratoid / rhabdoid tumor 1.600 1.1e-03
ependymoma 2.000 8.9e-04
glioblastoma 1.200 4.4e-02
group 4 medulloblastoma 2.000 5.1e-03
medulloblastoma, large-cell 2.400 5.6e-05
oligodendroglioma 2.400 4.7e-04
osteosarcoma 2.019 1.0e-07
ovarian cancer -1.400 2.8e-15
subependymal giant cell astrocytoma -1.748 4.3e-02

Gene RIF (3)

AA Sequence

MNWNKGGPGTKRGFGFGGFAISAGKKEEPKLPQQSHSAFGATSSSSGFGKSAPPQLPSFYKIGSKRANFD      1 - 70
EENAYFEDEEEDSSNVDLPYIPAENSPTRQQFHSKPVDSDSDDDPLEAFMAEVEDQAARDMKRLEEKDKE     71 - 140
RKNVKGIRDDIEEEDDQEAYFRYMAENPTAGVVQEEEEDNLEYDSDGNPIAPTKKIIDPLPPIDHSEIDY    141 - 210
PPFEKNFYNEHEEITNLTPQQLIDLRHKLNLRVSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQ    211 - 280
CQGVPVALSGRDMIGIAKTGSGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFG    281 - 350
KAYNLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFEYQ    351 - 420
VRSIASHVRPDRQTLLFSATFRKKIEKLARDILIDPIRVVQGDIGEANEDVTQIVEILHSGPSKWNWLTR    421 - 490
RLVEFTSSGSVLLFVTKKANAEELANNLKQEGHNLGLLHGDMDQSERNKVISDFKKKDIPVLVATDVAAR    491 - 560
GLDIPSIKTVINYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLD    561 - 630
LAMQNAWFRKSRFKGGKGKKLNIGGGGLGYRERPGLGSENMDRGNNNVMSNYEAYKPSTGAMGDRLTAMK    631 - 700
AAFQSQYKSHFVAASLSNQKAGSSAAGASGWTSAGSLNSVPTNSAQQGHNSPDSPVTSAAKGIPGFGNTG    701 - 770
NISGAPVTYPSAGAQGVNNTASGNNSREGTGGSNGKRERYTENRGSSRHSHGETGNRHSDSPRHGDGGRH    771 - 840
GDGYRHPESSSRHTDGHRHGENRHGGSAGRHGENRGANDGRNGESRKEAFNRESKMEPKMEPKVDSSKMD    841 - 910
KVDSKTDKTADGFAVPEPPKRKKSRWDS                                              911 - 938
//

Text Mined References (27)

PMID Year Title