Property Summary

NCBI Gene PubMed Count 30
Grant Count 5
Funding $1,084,461.98
PubMed Score 28.90
PubTator Score 28.24

Knowledge Summary

Patent (587)

Expression

  Differential Expression (2)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.385 0.002
pancreatic cancer 1.200 0.007

Gene RIF (22)

PMID Text
26887948 DGKeta-Pleckstrin Homology Domain preferentially interacts with Phosphatidylinositol 4,5-Bisphosphate and has crucial roles in regulating the subcellular localization and physiological function of DGKeta.
25081328 These findings implicate a link between nucleotide variant of DGKH and a cause for a complex-trait disease, calcium oxalate stone
24958494 This study demonstrated that significant association of the DGKH risk haplotype with increased amygdala volume in Bipolar disorder, but not in schizophreia or healthy controls.
23177175 DGKK variants are associated with hypospadias
22048461 Differential effects of DGKH in healthy controls vs the bipolar high-risk group manifest as a failure to disengage default-mode regions in those at familial risk carrying the risk haplotype.
21654738 Four DGKH markers are linked to adult attention-hyperactivity disorder and seven to unipolar depression, making DGKH a risk factor gene for bipolar disorder, unipolar depression and adult attention-deficit hyperactivity disorder.
21548979 expressions of DGKeta and DGKzeta were increased and decreased, respectively, whereas those of DGKgamma and DGKepsilon remained unchanged. This is the first report that describes the differential regulation of DGK isoforms in normal and failing human hearts.
21507135 Although the association was not strong, the result of this study would support the association between DGKH and BD.
20733578 The results of tisd support DGKH as shared risk factor of bipolar disorder and schizophrenia in the Chinese Han population.
20733578 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAGAGGQHHPPGAAGGAAAGAGAAVTSAAASAGPGEDSSDSEAEQEGPQKLIRKVSTSGQIRTKTSIKEG      1 - 70
QLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEASTKNANNSFTIITPFRRLMLCA     71 - 140
ENRKEMEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYACSHARPTFCNVCRESLSGVTSHGLSCEVCK    141 - 210
FKAHKRCAVRATNNCKWTTLASIGKDIIEDEDGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCL    211 - 280
WCKTMVHTACKDLYHPICPLGQCKVSIIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFL    281 - 350
RRFKQLLNPAQVFDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLGVLPLGTG    351 - 420
NDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPGPPEASEEFYMTIYED    421 - 490
SVATHLTKILNSDEHAVVISSAKTLCETVKDFVAKVEKTYDKTLENAVVADAVASKCSVLNEKLEQLLQA    491 - 560
LHTDSQAAPVLPGLSPLIVEEDAVESSSEESLGESKEQLGDDVTKPSSQKAVKPREIMLRANSLKKAVRQ    561 - 630
VIEEAGKVMDDPTVHPCEPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQTDSV    631 - 700
PGPAVAASKENLPVLNTRIICPGLRAGLAASIAGSSIINKMLLANIDPFGATPFIDPDLDSVDGYSEKCV    701 - 770
MNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLP    771 - 840
SLQGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSMQMAVSRVIKLQHHRIAQCRTVK    841 - 910
ITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWEDKQKCDSGKPVLRTHLYIHH    911 - 980
AIDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQELAHAVNACSHALNKANPRCPESLTRDTATEI    981 - 1050
AINVKALYNETESLLVGRVPLQLESPHEERVSNALHSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTKR   1051 - 1120
NNRSTVFRIVPKFKKEKVQKQKTSSQPVQKWGTEEVAAWLDLLNLGEYKDIFIRHDIRGAELLHLERRDL   1121 - 1190
KDLGIPKVGHVKRILQGIKELGRSTPQSEV                                           1191 - 1220
//

Publication (31)

PMID Year Title
26887948 2016 The Pleckstrin Homology Domain of Diacylglycerol Kinase ? Strongly and Selectively Binds to Phosphatidylinositol 4,5-Bisphosphate.
25221879 2014 Genome-wide interrogation of longitudinal FEV1 in children with asthma.
25081328 2014 Association study of DGKH gene polymorphisms with calcium oxalate stone in Chinese population.
24958494 2015 Influence of DGKH variants on amygdala volume in patients with bipolar affective disorder and schizophrenia.
24068962 2013 Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23177175 2013 Diacylglycerol kinase K variants impact hypospadias in a California study population.
22396660 2012 A genome-wide association study of nephrolithiasis in the Japanese population identifies novel susceptible Loci at 5q35.3, 7p14.3, and 13q14.1.
22048461 2012 Effect of variation in diacylglycerol kinase ? (DGKH) gene on brain function in a cohort at familial risk of bipolar disorder.
21654738 2011 Cross-disorder analysis of bipolar risk genes: further evidence of DGKH as a risk gene for bipolar disorder, but also unipolar depression and adult ADHD.
More...