Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.41
PubTator Score 3.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
psoriasis 6694 0.0e+00
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Splenic marginal zone lymphoma 7 3.294 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 4.500 0.0e+00

Gene RIF (9)

AA Sequence

MESLSPGGPPGHPYQGEASTCWQLTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFKTKTLTDTSHP      1 - 70
VWNEAFRFLIQSQVKNVLELSIYDEDSVTEDDICFKVLYDISEVLPGKLLRKTFSQSPQGEEELDVEFLM     71 - 140
EETSDRPENLITNKVIVARELSCLDVHLDSTGSTAVVADQDKLELELVLKGSYEDTQTSFLGTASAFRFH    141 - 210
YMAALETELSGRLRSSRSNGWNGDNSAGYLTVPLRPLTIGKEVTMDVPAPNAPGVRLQLKAEGCPEELAV    211 - 280
HLGFNLCAEEQAFLSRRKQVVAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGL    281 - 350
LDCVTYFSGISGSTWTMAHLYGDPEWSQRDLEGPIRYAREHLAKSKLEVFSPERLASYRRELELRAEQGH    351 - 420
PTTFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEWVEFSPYEVGF    421 - 490
LKYGAFVPPELFGSEFFMGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWYDLTSSGESWKQHIKDKTRSL    491 - 560
EKEPLTTSGTSSRLEASWLQPGTALAQAFKGFLTGRPLHQRSPNFLQGLQLHQDYCSHKDFSTWADYQLD    561 - 630
SMPSQLTPKEPRLCLVDAAYFINTSSPSMFRPGRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRV    631 - 700
EPSPQDQHQPRECHLFSDPACPEAPILLHFPLVNASFKDHSAPGVQRSPAELQGGQVDLTGATCPYTLSN    701 - 770
MTYKEEDFERLLRLSDYNVQTSQGAILQALRTALKHRTLEARPPRAQT                          771 - 818
//

Text Mined References (11)

PMID Year Title