Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.76
PubTator Score 3.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 4.500 0.000

Synonym

Accession Q86XP0 Q8N176 cPLA2-delta
Symbols cPLA2delta

Gene

PANTHER Protein Class (3)

PDB

5IXC   5IZ5   5IZR  

Gene RIF (9)

PMID Text
24349473 study defined eight additional recurrently mutated genes in SMZL; these genes are CREBBP, CBFA2T3, AMOTL1, FAT4, FBXO11, PLA2G4D, TRRAP and USH2A.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18686860 Observational study of gene-disease association. (HuGE Navigator)
16213696 Observational study of gene-disease association. (HuGE Navigator)
14709560 cPLA(2)delta exhibits a unique distribution pattern compared with that of known cPLA(2) subtypes and may play a critical role in inflammation in psoriatic lesions
9745929 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor
9745929 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor
9377118 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor

AA Sequence

MESLSPGGPPGHPYQGEASTCWQLTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFKTKTLTDTSHP      1 - 70
VWNEAFRFLIQSQVKNVLELSIYDEDSVTEDDICFKVLYDISEVLPGKLLRKTFSQSPQGEEELDVEFLM     71 - 140
EETSDRPENLITNKVIVARELSCLDVHLDSTGSTAVVADQDKLELELVLKGSYEDTQTSFLGTASAFRFH    141 - 210
YMAALETELSGRLRSSRSNGWNGDNSAGYLTVPLRPLTIGKEVTMDVPAPNAPGVRLQLKAEGCPEELAV    211 - 280
HLGFNLCAEEQAFLSRRKQVVAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGL    281 - 350
LDCVTYFSGISGSTWTMAHLYGDPEWSQRDLEGPIRYAREHLAKSKLEVFSPERLASYRRELELRAEQGH    351 - 420
PTTFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEWVEFSPYEVGF    421 - 490
LKYGAFVPPELFGSEFFMGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWYDLTSSGESWKQHIKDKTRSL    491 - 560
EKEPLTTSGTSSRLEASWLQPGTALAQAFKGFLTGRPLHQRSPNFLQGLQLHQDYCSHKDFSTWADYQLD    561 - 630
SMPSQLTPKEPRLCLVDAAYFINTSSPSMFRPGRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRV    631 - 700
EPSPQDQHQPRECHLFSDPACPEAPILLHFPLVNASFKDHSAPGVQRSPAELQGGQVDLTGATCPYTLSN    701 - 770
MTYKEEDFERLLRLSDYNVQTSQGAILQALRTALKHRTLEARPPRAQT                          771 - 818
//

Publication (9)

PMID Year Title
24349473 2013 Whole exome sequencing identifies novel recurrently mutated genes in patients with splenic marginal zone lymphoma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18686860 2008 [Study on the genetic association between the polymorphism of cytosolic phospholipase A2 family genes and schizophrenia].
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16213696 2005 A family based study of the genetic association between the PLA2G4D gene and schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14709560 2004 Cloning of a gene for a novel epithelium-specific cytosolic phospholipase A2, cPLA2delta, induced in psoriatic skin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.