Property Summary

NCBI Gene PubMed Count 6
PubMed Score 24.71
PubTator Score 15.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia -1.100 1.4e-02
adrenocortical carcinoma 1.054 1.7e-02
adult high grade glioma -1.200 3.1e-04
aldosterone-producing adenoma -1.097 3.2e-02
ductal carcinoma in situ 1.600 8.0e-05
glioblastoma 1.200 6.5e-03
group 3 medulloblastoma 1.200 1.8e-02
lung adenocarcinoma 1.600 3.2e-05
lung cancer 2.700 5.4e-04
osteosarcoma 2.405 8.3e-05
pancreatic cancer 1.100 2.9e-04
primitive neuroectodermal tumor 1.500 2.9e-05
subependymal giant cell astrocytoma -1.091 1.3e-02

AA Sequence

MPSSLGQPDGGGGGGGGGGGVGAAGEDPGPGPAPPPEGAQEAAPAPRPPPEPDDAAAALRLALDQLSALG      1 - 70
LGGAGDTDEEGAAGDGAAAAGGADGGAAPEPVPPDGPEAGAPPTLAPAVAPGSLPLLDPNASPPPPPPPR     71 - 140
PSPPDVFAGFAPHPAALGPPTLLADQMSVIGSRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTN    141 - 210
TYIKTPVRGEEPVFIVTGRKEDVEMAKREILSAAEHFSIIRATRSKAGGLPGAAQGPPNLPGQTTIQVRV    211 - 280
PYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDKEPVFAVTGMPENVDRAREEIEAHITLRTGAFTDAGP    281 - 350
DSDFHANGTDVCLDLLGAAASLWAKTPNQGRRPPTATAGLRGDTALGAPSAPEAFYAGSRGGPSVPDPGP    351 - 420
ASPYSGSGNGGFAFGAEGPGAPVGTAAPDDCDFGFDFDFLALDLTVPAAATIWAPFERAAPLPAFSGCST    421 - 490
VNGAPGPPAAGARRSSGAGTPRHSPTLPEPGGLRLELPLSRRGAPDPVGALSWRPPQGPVSFPGGAAFST    491 - 560
ATSLPSSPAAAACAPLDSGASENSRKPPSASSAPALARECVVCAEGEVMAALVPCGHNLFCMDCAVRICG    561 - 630
KSEPECPACRTPATQAIHIFS                                                     631 - 651
//

Text Mined References (8)

PMID Year Title