Property Summary

NCBI Gene PubMed Count 6
PubMed Score 20.94
PubTator Score 15.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 5.2837138109762E-6
primitive neuroectodermal tumor 3031 2.94749113465192E-5
lung adenocarcinoma 2714 3.19428735230945E-5
ductal carcinoma in situ 1745 7.95879222317204E-5
osteosarcoma 7933 8.28305234477074E-5
pancreatic cancer 2300 2.89327015224192E-4
pediatric high grade glioma 2712 4.5885296452943E-4
lung cancer 4473 5.42635291554457E-4
glioblastoma 5572 0.00648709079524807
acute myeloid leukemia 785 0.0118974302977204
subependymal giant cell astrocytoma 2287 0.0134733081819836
adrenocortical carcinoma 1427 0.0173026346984847
aldosterone-producing adenoma 664 0.0316452650497146
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 2 19 3.248 1.6

Expression

  Differential Expression (13)

Synonym

Accession Q86XN8 A0PJL8 A1L023 E9PAL6 Q71M49
Symbols MEX3
TINO
RKHD1
MEX-3D
RNF193
OK/SW-cl.4

Gene

PDB

2DGR  

  Ortholog (4)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid

Pathway (1)

AA Sequence

MPSSLGQPDGGGGGGGGGGGVGAAGEDPGPGPAPPPEGAQEAAPAPRPPPEPDDAAAALRLALDQLSALG      1 - 70
LGGAGDTDEEGAAGDGAAAAGGADGGAAPEPVPPDGPEAGAPPTLAPAVAPGSLPLLDPNASPPPPPPPR     71 - 140
PSPPDVFAGFAPHPAALGPPTLLADQMSVIGSRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTN    141 - 210
TYIKTPVRGEEPVFIVTGRKEDVEMAKREILSAAEHFSIIRATRSKAGGLPGAAQGPPNLPGQTTIQVRV    211 - 280
PYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDKEPVFAVTGMPENVDRAREEIEAHITLRTGAFTDAGP    281 - 350
DSDFHANGTDVCLDLLGAAASLWAKTPNQGRRPPTATAGLRGDTALGAPSAPEAFYAGSRGGPSVPDPGP    351 - 420
ASPYSGSGNGGFAFGAEGPGAPVGTAAPDDCDFGFDFDFLALDLTVPAAATIWAPFERAAPLPAFSGCST    421 - 490
VNGAPGPPAAGARRSSGAGTPRHSPTLPEPGGLRLELPLSRRGAPDPVGALSWRPPQGPVSFPGGAAFST    491 - 560
ATSLPSSPAAAACAPLDSGASENSRKPPSASSAPALARECVVCAEGEVMAALVPCGHNLFCMDCAVRICG    561 - 630
KSEPECPACRTPATQAIHIFS                                                     631 - 651
//

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
17267406 2007 Identification and characterization of human Mex-3 proteins, a novel family of evolutionarily conserved RNA-binding proteins differentially localized to processing bodies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14769789 2004 Identification of TINO: a new evolutionarily conserved BCL-2 AU-rich element RNA-binding protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.