Property Summary

NCBI Gene PubMed Count 12
Grant Count 1
Funding $57,962
PubMed Score 11.26
PubTator Score 2.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.045 0.002
sonic hedgehog group medulloblastoma 1.300 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.018
colon cancer 1.200 0.000
nasopharyngeal carcinoma 1.100 0.000
spina bifida -1.133 0.039
gastric carcinoma 1.300 0.035
ovarian cancer 2.400 0.000

Synonym

Accession Q86XL3 A8KAG3 B3KN97 B3KSF8 O75176 Q6P6A5 Q8TAZ9 Q96DH4
Symbols Lem4
LEMD7
MCPH16
KIAA0692

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
22770216 By coordinating VRK-1- and PP2A-mediated signaling on BAF, Lem4 and LEM-4L (Y55F3BR.8) controls postmitotic nuclear envelope formation in a function conserved from worms to humans.

AA Sequence

MLWPRLAAAEWAALAWELLGASVLLIAVRWLVRRLGPRPGGLGRSGTPVPPPSAAAAPASGEMTMDALLA      1 - 70
RLKLLNPDDLREEIVKAGLKCGPITSTTRFIFEKKLAQALLEQGGRLSSFYHHEAGVTALSQDPQRILKP     71 - 140
AEGNPTDQAGFSEDRDFGYSVGLNPPEEEAVTSKTCSVPPSDTDTYRAGATASKEPPLYYGVCPVYEDVP    141 - 210
ARNERIYVYENKKEALQAVKMIKGSRFKAFSTREDAEKFARGICDYFPSPSKTSLPLSPVKTAPLFSNDR    211 - 280
LKDGLCLSESETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGC    281 - 350
RYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFAC    351 - 420
KFGNADVVNVLSSHHLIVKNSRNKYDKTPEDVICERSKNKSVELKERIREYLKGHYYVPLLRAEETSSPV    421 - 490
IGELWSPDQTAEASHVSRYGGSPRDPVLTLRAFAGPLSPAKAEDFRKLWKTPPREKAGFLHHVKKSDPER    491 - 560
GFERVGRELAHELGYPWVEYWEFLGCFVDLSSQEGLQRLEEYLTQQEIGKKAQQETGEREASCRDKATTS    561 - 630
GSNSISVRAFLDEDDMSLEEIKNRQNAARNNSPPTVGAFGHTRCSAFPLEQEADLIEAAEPGGPHSSRNG    631 - 700
LCHPLNHSRTLAGKRPKAPRGEEAHLPPVSDLTVEFDKLNLQNIGRSVSKTPDESTKTKDQILTSRINAV    701 - 770
ERDLLEPSPADQLGNGHRRTESEMSARIAKMSLSPSSPRHEDQLEVTREPARRLFLFGEEPSKLDQDVLA    771 - 840
ALECADVDPHQFPAVHRWKSAVLCYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKP    841 - 910
GLGSPGRYSPVHGSQLRRMARLAELAAL                                              911 - 938
//

Text Mined References (21)

PMID Year Title
25259927 2014 A drosophila genetic resource of mutants to study mechanisms underlying human genetic diseases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22770216 2012 Coordination of kinase and phosphatase activities by Lem4 enables nuclear envelope reassembly during mitosis.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...