Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.79
PubTator Score 2.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
MICROCEPHALY 16, PRIMARY, AUTOSOMAL RECESSIVE 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
Microcephaly 166 0.0 4.0

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer 1.200 1.1e-04
gastric carcinoma 1.300 3.5e-02
intraductal papillary-mucinous neoplasm ... 1.500 1.8e-02
medulloblastoma 1.100 4.7e-07
nasopharyngeal carcinoma 1.100 1.6e-04
osteosarcoma -1.045 1.5e-03
ovarian cancer 2.400 2.1e-06
spina bifida -1.133 3.9e-02

Gene RIF (2)

AA Sequence

MLWPRLAAAEWAALAWELLGASVLLIAVRWLVRRLGPRPGGLGRSGTPVPPPSAAAAPASGEMTMDALLA      1 - 70
RLKLLNPDDLREEIVKAGLKCGPITSTTRFIFEKKLAQALLEQGGRLSSFYHHEAGVTALSQDPQRILKP     71 - 140
AEGNPTDQAGFSEDRDFGYSVGLNPPEEEAVTSKTCSVPPSDTDTYRAGATASKEPPLYYGVCPVYEDVP    141 - 210
ARNERIYVYENKKEALQAVKMIKGSRFKAFSTREDAEKFARGICDYFPSPSKTSLPLSPVKTAPLFSNDR    211 - 280
LKDGLCLSESETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGC    281 - 350
RYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFAC    351 - 420
KFGNADVVNVLSSHHLIVKNSRNKYDKTPEDVICERSKNKSVELKERIREYLKGHYYVPLLRAEETSSPV    421 - 490
IGELWSPDQTAEASHVSRYGGSPRDPVLTLRAFAGPLSPAKAEDFRKLWKTPPREKAGFLHHVKKSDPER    491 - 560
GFERVGRELAHELGYPWVEYWEFLGCFVDLSSQEGLQRLEEYLTQQEIGKKAQQETGEREASCRDKATTS    561 - 630
GSNSISVRAFLDEDDMSLEEIKNRQNAARNNSPPTVGAFGHTRCSAFPLEQEADLIEAAEPGGPHSSRNG    631 - 700
LCHPLNHSRTLAGKRPKAPRGEEAHLPPVSDLTVEFDKLNLQNIGRSVSKTPDESTKTKDQILTSRINAV    701 - 770
ERDLLEPSPADQLGNGHRRTESEMSARIAKMSLSPSSPRHEDQLEVTREPARRLFLFGEEPSKLDQDVLA    771 - 840
ALECADVDPHQFPAVHRWKSAVLCYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKP    841 - 910
GLGSPGRYSPVHGSQLRRMARLAELAAL                                              911 - 938
//

Text Mined References (26)

PMID Year Title