Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.61
PubTator Score 5.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung carcinoma 413 5.78721500697195E-10
urothelial carcinoma 318 2.3790804246459E-8
sarcoidosis 368 1.48434862504101E-5
lung adenocarcinoma 2714 3.76002686856002E-5
pancreatic cancer 2300 3.1834900284211E-4
tuberculosis and treatment for 6 months 686 3.26406418658314E-4
ulcerative colitis 2087 4.66396827170915E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 6.1108790915106E-4
uncontrolled asthma 67 0.00401563812116016
pituitary cancer 1972 0.0220507008368645
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0228866599265047
interstitial lung disease 292 0.0229861540319738
interstitial cystitis 2299 0.0382247333073854

Expression

Synonym

Accession Q86XK7 C9J4P2 Q6MZS4
Symbols GPA34
dJ889N15.1
1700062D20Rik

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
22095633 VSIG1 expression was significantly reduced at both the mRNA and protein levels in gastric cancer tissues. loss of VSIG1 expression was significantly correlated with poor overall survival and disease-free survival in gastric cancer patients.
16405301 expressed, both at the mRNA and protein level, in gastric, esophageal, and ovarian cancers, while expression in normal tissues was restricted to testis and stomach

AA Sequence

MVFAFWKVFLILSCLAGQVSVVQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPI      1 - 70
SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKP     71 - 140
SKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQ    141 - 210
CTAINRLGNSSCEIDLTSSHPEVGIIVGALIGSLVGAAIIISVVCFARNKAKAKAKERNSKTIAELEPMT    211 - 280
KINPRGESEAMPREDATQLEVTLPSSIHETGPDTIQEPDYEPKPTQEPAPEPAPGSEPMAVPDLDIELEL    281 - 350
EPETQSELEPEPEPEPESEPGVVVEPLSEDEKGVVKA                                     351 - 387
//

Text Mined References (7)

PMID Year Title
22095633 2012 Decreased expression of V-set and immunoglobulin domain containing 1 (VSIG1) is associated with poor prognosis in primary gastric cancer.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16405301 2006 Glycoprotein A34, a novel target for antibody-based cancer immunotherapy.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.