Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.56
PubTator Score 5.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
interstitial cystitis -1.300 3.8e-02
interstitial lung disease 2.300 2.3e-02
intraductal papillary-mucinous adenoma (... 4.000 1.2e-05
intraductal papillary-mucinous carcinoma... 4.500 2.3e-02
lung adenocarcinoma 2.200 3.8e-05
non-small cell lung carcinoma 2.000 5.8e-10
pancreatic cancer 1.900 2.3e-03
pituitary cancer -1.200 2.2e-02
sarcoidosis -1.400 1.5e-05
tuberculosis -1.100 3.8e-03
ulcerative colitis 1.600 5.8e-03
uncontrolled asthma 1.400 4.0e-03
urothelial carcinoma -1.900 5.2e-09

Gene RIF (3)

AA Sequence

MVFAFWKVFLILSCLAGQVSVVQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPI      1 - 70
SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKP     71 - 140
SKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQ    141 - 210
CTAINRLGNSSCEIDLTSSHPEVGIIVGALIGSLVGAAIIISVVCFARNKAKAKAKERNSKTIAELEPMT    211 - 280
KINPRGESEAMPREDATQLEVTLPSSIHETGPDTIQEPDYEPKPTQEPAPEPAPGSEPMAVPDLDIELEL    281 - 350
EPETQSELEPEPEPEPESEPGVVVEPLSEDEKGVVKA                                     351 - 387
//

Text Mined References (8)

PMID Year Title