Property Summary

NCBI Gene PubMed Count 34
PubMed Score 34.09
PubTator Score 22.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 4.3e-02
Breast cancer 2.700 3.8e-02
group 3 medulloblastoma 1.400 8.4e-04
lung cancer -1.300 6.7e-03
non primary Sjogren syndrome sicca -1.200 1.8e-02
non-small cell lung cancer 1.120 1.7e-14
osteosarcoma -1.923 7.6e-06
ovarian cancer -2.000 8.4e-11
pancreatic ductal adenocarcinoma liver m... 1.389 5.6e-03
psoriasis -1.100 1.2e-03
tuberculosis and treatment for 6 months 1.200 7.3e-03

Gene RIF (19)

AA Sequence

MNSVRAANRRPRRVSRPRPVQQQQQQPPQQPPPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLPQE      1 - 70
RNNVGERDDDVPADMVAEESGPGAQNSPYQLRRKTLLPKRTACPTKNSMEGASTSTTENFGHRAKRARVS     71 - 140
GKSQDLSAAPAEQYLQEKLPDEVVLKIFSYLLEQDLCRAACVCKRFSELANDPILWKRLYMEVFEYTRPM    141 - 210
MHPEPGKFYQINPEEYEHPNPWKESFQQLYKGAHVKPGFAEHFYSNPARYKGRENMLYYDTIEDALGGVQ    211 - 280
EAHFDGLIFVHSGIYTDEWIYIESPITMIGAAPGKVADKVIIENTRDSTFVFMEGSEDAYVGYMTIRFNP    281 - 350
DDKSAQHHNAHHCLEITVNCSPIIDHCIIRSTCTVGSAVCVSGQGACPTIKHCNISDCENVGLYITDHAQ    351 - 420
GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANP    421 - 490
TVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGL    491 - 560
IEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVL    561 - 630
RRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIE    631 - 700
DNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPILRK    701 - 770
NRIFDGFAAGIEITNHATATLEGNQIFNNRFGGLFLASGVNVTMKDNKIMNNQDAIEKAVSRGQCLYKIS    771 - 840
SYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTD    841 - 910
TLYDSAPPIESNTLQHN                                                         911 - 927
//

Text Mined References (39)

PMID Year Title