Property Summary

NCBI Gene PubMed Count 31
Grant Count 33
R01 Count 16
Funding $4,118,291.05
PubMed Score 28.92
PubTator Score 22.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 0.043
psoriasis -1.200 0.000
osteosarcoma -1.923 0.000
tuberculosis and treatment for 6 months 1.200 0.007
pancreatic ductal adenocarcinoma liver m... 1.389 0.006
non-small cell lung cancer 1.120 0.000
lung cancer -1.300 0.007
Breast cancer 2.700 0.038
group 3 medulloblastoma 1.400 0.001
non primary Sjogren syndrome sicca -1.200 0.018
ovarian cancer -2.000 0.000

 GWAS Trait (1)

Gene RIF (19)

PMID Text
26187670 siRNA-mediated knockdown of FBXO11 facilitated HIF-1alpha expression in various cancer cells and HIF-1alpha-driven gene expressions, but the FBXO10 knockdown did not.
26059563 UBR3/6 regulate cardiomyocyte Nav 1.5 channel protein levels via the ubiquitin-proteasome pathway.
25867061 FBXO11 is a direct target of miR-621 in breast cancer cells.
25589783 Our results identify FBXO11 as a novel miR-21 target gene, and demonstrate that the oncogenic miRNA miR-21 decreases the expression of FBXO11, which normally acts as a tumor suppressor, and thereby promotes tumorigenesis.
25203322 The PKD1-FBXO11-SNAIL axis is a mechanism of posttranslational regulation of epithelial-mesenchymal transition and cancer metastasis.
24349473 study defined eight additional recurrently mutated genes in SMZL; these genes are CREBBP, CBFA2T3, AMOTL1, FAT4, FBXO11, PLA2G4D, TRRAP and USH2A.
23892434 TGF-beta signaling promotes exit from the cell cycle and cellular migration through cullin cross-regulation: SCF-FBXO11 turns off CRL4-Cdt2.
23478445 Migration of epithelial cells is stimulated by CRL1(FBXO11)-mediated downregulation of Cdt2 and the consequent stabilization of Set8.
23478441 The functional interaction between FBXO11 and CDT2 is evolutionary conserved from worms to humans and plays an important role in regulating the timing of cell-cycle exit.
23110726 Depletion of F-box protein 11 (FBXO11) by siRNA enhances HIV-1 Tat activation of HIV-1 LTR, which is not the results of increased Tat expression and release of CDK9/CCNT1 from 7SK snRNP, and activation of NF-kappaB
More...

AA Sequence

MNSVRAANRRPRRVSRPRPVQQQQQQPPQQPPPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLPQE      1 - 70
RNNVGERDDDVPADMVAEESGPGAQNSPYQLRRKTLLPKRTACPTKNSMEGASTSTTENFGHRAKRARVS     71 - 140
GKSQDLSAAPAEQYLQEKLPDEVVLKIFSYLLEQDLCRAACVCKRFSELANDPILWKRLYMEVFEYTRPM    141 - 210
MHPEPGKFYQINPEEYEHPNPWKESFQQLYKGAHVKPGFAEHFYSNPARYKGRENMLYYDTIEDALGGVQ    211 - 280
EAHFDGLIFVHSGIYTDEWIYIESPITMIGAAPGKVADKVIIENTRDSTFVFMEGSEDAYVGYMTIRFNP    281 - 350
DDKSAQHHNAHHCLEITVNCSPIIDHCIIRSTCTVGSAVCVSGQGACPTIKHCNISDCENVGLYITDHAQ    351 - 420
GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANP    421 - 490
TVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGL    491 - 560
IEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVL    561 - 630
RRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIE    631 - 700
DNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPILRK    701 - 770
NRIFDGFAAGIEITNHATATLEGNQIFNNRFGGLFLASGVNVTMKDNKIMNNQDAIEKAVSRGQCLYKIS    771 - 840
SYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTD    841 - 910
TLYDSAPPIESNTLQHN                                                         911 - 927
//

Publication (36)

PMID Year Title
26187670 2015 FBXO11 represses cellular response to hypoxia by destabilizing hypoxia-inducible factor-1? mRNA.
26059563 2015 Cardiac Nav 1.5 is modulated by ubiquitin protein ligase E3 component n-recognin UBR3 and 6.
25867061 2016 MiRNA-621 sensitizes breast cancer to chemotherapy by suppressing FBXO11 and enhancing p53 activity.
25589783 2015 The oncogenic microRNA-21 inhibits the tumor suppressive activity of FBXO11 to promote tumorigenesis.
25416956 2014 A proteome-scale map of the human interactome network.
25203322 2014 PKD1 phosphorylation-dependent degradation of SNAIL by SCF-FBXO11 regulates epithelial-mesenchymal transition and metastasis.
24968003 2014 BLMP-1/Blimp-1 regulates the spatiotemporal cell migration pattern in C. elegans.
24613396 2014 DRE-1/FBXO11-dependent degradation of BLMP-1/BLIMP-1 governs C. elegans developmental timing and maturation.
24349473 2013 Whole exome sequencing identifies novel recurrently mutated genes in patients with splenic marginal zone lymphoma.
23894747 2013 A comprehensive family-based replication study of schizophrenia genes.
More...