Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.75
PubTator Score 7.83

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
24571573 show that the GAR domain of GAS2L3 is required for localization of GAS2L3 to the constriction zone
23469016 show that the Gas2l3 protein is targeted for ubiquitin-mediated proteolysis by the APC/C(Cdh1) complex, but not by the APC/C(Cdc20) complex, and is phosphorylated by Cdk1 in mitosis
22344256 GAS2L3, a target gene of the DREAM complex, is required for cytokinesis and genomic stability.
21561867 tubulin acetylation drives GAS2-like 3 localization to MTs and may provide functional insights into the role of GAS2-like 3.

AA Sequence

MQPAIQVWFGEDLPLSPRSPLTPRHGPGLANVCQYDEWIAVRHEATLLPMQEDLSIWLSGLLGIKVKAEK      1 - 70
LLEELDNGVLLCQLIDVLQNMVKTCNSEESGNFPMRKVPCKKDAASGSFFARDNTANFLHWCRDIGVDET     71 - 140
YLFESEGLVLHKDPRQVYLCLLEIGRIVSRYGVEPPVLVKLEKEIELEETLLNTSGPEDSISIPKSCCRH    141 - 210
EELHEAVKHIAEDPPCSCSHRFSIEYLSEGRYRLGDKILFIRMLHGKHVMVRVGGGWDTLQGFLLKYDPC    211 - 280
RILQFATLEQKILAFQKGVSNESVPDSPARTPQPPEMNPLSAVNMFQKQNSKPSVPVSIPKSKEKQGRPP    281 - 350
GALVPASSLKGGNLGSMSVRSKLPNSPAASSHPKLKSSKGITKKPQAPSNNASSSLASLNPVGKNTSSPA    351 - 420
LPRTAPCISESPRKCISSPNTPKAKVIPAQNSADLPESTLLPNKCSGKTQPKYLKHNHISSRDNAVSHLA    421 - 490
AHSNSSSKCPKLPKANIPVRPKPSFQSSAKMTKTSSKTIATGLGTQSQPSDGAPQAKPVPAQKLKSALNL    491 - 560
NQPVSVSSVSPVKATQKSKDKNIVSATKKQPQNKSAFQKTGPSSLKSPGRTPLSIVSLPQSSTKTQTAPK    561 - 630
SAQTVAKSQHSTKGPPRSGKTPASIRKPPSSVKDADSGDKKPTAKKKEDDDHYFVMTGSKKPRK          631 - 694
//

Publication (11)

PMID Year Title
24571573 2014 The GAR domain of GAS2L3 mediates binding to the chromosomal passenger complex and is required for localization of GAS2L3 to the constriction zone during abscission.
23469016 2013 Gas2l3, a novel constriction site-associated protein whose regulation is mediated by the APC/C Cdh1 complex.
23341777 2013 Genome-wide association study identifies a novel susceptibility locus at 12q23.1 for lung squamous cell carcinoma in han chinese.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22344256 2012 GAS2L3, a target gene of the DREAM complex, is required for proper cytokinesis and genomic stability.
21561867 2011 Characterization of G2L3 (GAS2-like 3), a new microtubule- and actin-binding protein related to spectraplakins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...