Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.35
PubTator Score 0.94

Knowledge Summary

Patent (902)

Expression

Gene RIF (3)

AA Sequence

MDKFRMLFQHFQSSSESVMNGICLLLAAVTVKLYSSFDFNCPCLVHYNALYGLGLLLTPPLALFLCGLLA      1 - 70
NRQSVVMVEEWRRPAGHRRKDPGIIRYMCSSVLQRALAAPLVWILLALLDGKCFVCAFSSSVDPEKFLDF     71 - 140
ANMTPSQVQLFLAKVPCKEDELVRDSPARKAVSRYLRCLSQAIGWSVTLLLIIAAFLARCLRPCFDQTVF    141 - 210
LQRRYWSNYVDLEQKLFDETCCEHARDFAHRCVLHFFASMRSELQARGLRRGNAGRRLELPAVPEPPAVP    211 - 280
EPPEGLDSGSGKAHLRAISSREQVDRLLSTWYSSKPPLDLAASPGLCGGGLSHRAPTLALGTRLSQHTDV    281 - 350
//

Text Mined References (8)

PMID Year Title