Property Summary

NCBI Gene PubMed Count 7
Grant Count 4
R01 Count 3
Funding $392,199.99
PubMed Score 0.35
PubTator Score 0.94

Knowledge Summary

Patent (902)

Expression

Gene RIF (3)

PMID Text
20164573 This study failed to show an association between theeight SNPs of the CALHM3 genes and alzheimer disease.
20164573 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDKFRMLFQHFQSSSESVMNGICLLLAAVTVKLYSSFDFNCPCLVHYNALYGLGLLLTPPLALFLCGLLA      1 - 70
NRQSVVMVEEWRRPAGHRRKDPGIIRYMCSSVLQRALAAPLVWILLALLDGKCFVCAFSSSVDPEKFLDF     71 - 140
ANMTPSQVQLFLAKVPCKEDELVRDSPARKAVSRYLRCLSQAIGWSVTLLLIIAAFLARCLRPCFDQTVF    141 - 210
LQRRYWSNYVDLEQKLFDETCCEHARDFAHRCVLHFFASMRSELQARGLRRGNAGRRLELPAVPEPPAVP    211 - 280
EPPEGLDSGSGKAHLRAISSREQVDRLLSTWYSSKPPLDLAASPGLCGGGLSHRAPTLALGTRLSQHTDV    281 - 350
//

Publication (8)

PMID Year Title
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
20164573 2010 Genetic association between CALHM1, 2, and 3 polymorphisms and Alzheimer's disease in a Japanese population.
19997627 2009 Expression of genes encoding multi-transmembrane proteins in specific primate taste cell populations.
18585350 2008 A polymorphism in CALHM1 influences Ca2+ homeostasis, Abeta levels, and Alzheimer's disease risk.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.