Property Summary

NCBI Gene PubMed Count 27
PubMed Score 264.86
PubTator Score 15.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 1.19951682539857E-14
ovarian cancer 8492 2.60167661935706E-11
pilocytic astrocytoma 3086 2.30394475491099E-9
posterior fossa group A ependymoma 1511 2.77941598247831E-7
pediatric high grade glioma 2712 3.30063362500164E-6
pancreatic cancer 2300 9.6878811045038E-6
tuberculosis 1563 1.28699500111597E-5
cystic fibrosis 1670 2.60271638835913E-5
glioblastoma 5572 6.40462162402679E-5
atypical teratoid / rhabdoid tumor 4369 1.02063975425293E-4
acute quadriplegic myopathy 1157 1.31949107810049E-4
medulloblastoma, large-cell 6234 1.80941088198459E-4
osteosarcoma 7933 4.63107634541528E-4
ulcerative colitis 2087 0.00286206155552736
pituitary cancer 1972 0.00337172556716055
interstitial cystitis 2299 0.00380394205405925
aldosterone-producing adenoma 664 0.00654457972497325
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00918709515859758
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0129018842789369
adrenocortical carcinoma 1427 0.0159663530619538
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0210644734214323
subependymal giant cell astrocytoma 2287 0.0302056784986198
spina bifida 1064 0.0360372103609784
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 2.0
Globe disease 57 0.0 1.0

Expression

Synonym

Accession Q86XI6 B3KTV3 Q9H812
Symbols GL
PTG
PPP1R4

Gene

PDB

2EEF  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (5)

PMID Text
23898208 HIV-1 Tat upregulates the expression of protein phosphatase 1, regulatory subunit 3B (PPP1R3B) in human primary T cells
23416328 Some, but not all, associations between variants in NCAN, lysophospholipase-like 1, GCKR, and PPP1R3B with hepatic steatosis (with and without increased ALT level) were significant within subpopulations.
23343124 Data indicate that genetic polymorphisms of the PPP1R3B gene may contribute to variations in plasma lipids and C-reactive protein (CRP) levels among Chinese Han individuals.
20864672 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
17555403 Results suggest that in cultured human myotubes, glycogen-targeting PP1 (protein phosphatase 1) subunit G(L) (coded for by the PPP1R3B gene) is expressed as in muscle tissue and is unresponsive to glucose or insulin, as are G(M) and PTG genes.

AA Sequence

MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQG      1 - 70
LALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVL     71 - 140
KDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEF    141 - 210
AVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEK    211 - 280
LGPYY                                                                     281 - 285
//

Text Mined References (29)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23903356 2013 Identification of HKDC1 and BACE2 as genes influencing glycemic traits during pregnancy through genome-wide association studies.
23726366 2013 Genome-wide characterization of shared and distinct genetic components that influence blood lipid levels in ethnically diverse human populations.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23416328 2013 Association between variants in or near PNPLA3, GCKR, and PPP1R3B with ultrasound-defined steatosis based on data from the third National Health and Nutrition Examination Survey.
23343124 2013 Association of PPP1R3B polymorphisms with blood lipid and C-reactive protein levels in a Chinese population (PPP1R3B C ).
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
More...