Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.73
PubTator Score 22.01

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86XE5 A8K075 Q5T680 Q5T684 Q711P0 Q8N9F2 Q96EV5
Symbols HP3
NPL2
DHDPS2
DHDPSL
C10orf65

Gene

PANTHER Protein Class (1)

PDB

3S5N   3S5O  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MLGPQVWSSVRQGLSRSLSRNVGVWASGEGKKVDIAGIYPPVTTPFTATAEVDYGKLEENLHKLGTFPFR      1 - 70
GFVVQGSNGEFPFLTSSERLEVVSRVRQAMPKNRLLLAGSGCESTQATVEMTVSMAQVGADAAMVVTPCY     71 - 140
YRGRMSSAALIHHYTKVADLSPIPVVLYSVPANTGLDLPVDAVVTLSQHPNIVGMKDSGGDVTRIGLIVH    141 - 210
KTRKQDFQVLAGSAGFLMASYALGAVGGVCALANVLGAQVCQLERLCCTGQWEDAQKLQHRLIEPNAAVT    211 - 280
RRFGIPGLKKIMDWFGYYGGPCRAPLQELSPAEEEALRMDFTSNGWL                           281 - 327
//

Text Mined References (18)

PMID Year Title