Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.14
PubTator Score 0.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 3.60009082343705E-32
lung carcinoma 2844 2.6484227010839E-15
oligodendroglioma 2849 1.61316981041096E-14
ependymoma 2514 1.2894934500688E-12
atypical teratoid / rhabdoid tumor 4369 2.81729917914786E-6
breast carcinoma 1614 3.07844521612282E-6
glioblastoma 5572 9.1774046458059E-6
pilocytic astrocytoma 3086 1.2895986978411E-5
lung adenocarcinoma 2714 1.57824745514893E-5
pediatric high grade glioma 2712 3.190611912837E-5
ovarian cancer 8492 5.01557763678214E-5
invasive ductal carcinoma 2950 5.17141024696274E-5
medulloblastoma 1524 7.28182876293779E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.98253876786997E-4
medulloblastoma, large-cell 6234 3.88626520195751E-4
ductal carcinoma in situ 1745 4.48156679784191E-4
primitive neuroectodermal tumor 3031 6.51277200800778E-4
tuberculosis 1563 0.00425740990382567
astrocytic glioma 2241 0.00545866083572063
Atopic dermatitis 944 0.00802565059302067
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0175924279340252
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0203741942320419

Expression

  Differential Expression (22)

Synonym

Accession Q86XE3 Q8IYZ3
Symbols EFHA2

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA Inparanoid

AA Sequence

MAALRRLLWPPPRVSPPLCAHQPLLGPWGRPAVTTLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVA      1 - 70
AAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIPVAAAKETVAIGRTDIEDLDL     71 - 140
YATSRERRFRLFASIECEGQLFMTPYDFILAVTTDEPKVAKTWKSLSKQELNQMLAETPPVWKGSSKLFR    141 - 210
NLKEKGVISYTEYLFLLCILTKPHAGFRIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKREIKGDEEKR    211 - 280
AMLRLQLYGYHSPTNSVLKTDAEELVSRSYWDTLRRNTSQALFSDLAERADDITSLVTDTTLLVHFFGKK    281 - 350
GKAELNFEDFYRFMDNLQTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSIPEEKG    351 - 420
ITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKFSPHLVNTVFKIFDVDKDDQL    421 - 490
SYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR                                  491 - 530
//

Text Mined References (5)

PMID Year Title
23409044 2013 MICU2, a paralog of MICU1, resides within the mitochondrial uniporter complex to regulate calcium handling.
22064162 2012 Genome-wide association study of comorbid depressive syndrome and alcohol dependence.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.