Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.14
PubTator Score 0.85

Knowledge Summary


No data available


  Differential Expression (22)

AA Sequence

SYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR                                  491 - 530

Publication (5)

PMID Year Title
23409044 2013 MICU2, a paralog of MICU1, resides within the mitochondrial uniporter complex to regulate calcium handling.
22064162 2012 Genome-wide association study of comorbid depressive syndrome and alcohol dependence.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.