Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.14
PubTator Score 0.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -2.300 5.9e-04
astrocytic glioma -1.900 5.5e-03
Astrocytoma, Pilocytic -2.100 9.0e-06
Atopic dermatitis -1.100 8.0e-03
atypical teratoid / rhabdoid tumor -2.700 2.8e-06
Breast cancer -2.500 2.8e-02
breast carcinoma -1.800 3.1e-06
ductal carcinoma in situ -1.900 4.5e-04
ependymoma -1.700 7.5e-03
glioblastoma -2.300 2.6e-07
group 3 medulloblastoma -2.900 1.0e-02
intraductal papillary-mucinous adenoma (... -2.000 2.0e-02
intraductal papillary-mucinous carcinoma... -3.000 3.0e-04
invasive ductal carcinoma -2.800 5.2e-05
lung adenocarcinoma -1.400 1.6e-05
lung carcinoma 1.200 2.6e-15
medulloblastoma, large-cell -2.900 3.9e-04
oligodendroglioma -1.600 1.6e-14
ovarian cancer -2.700 5.0e-05
pancreatic ductal adenocarcinoma liver m... -1.379 1.8e-02
primitive neuroectodermal tumor -1.700 6.5e-04
tuberculosis -1.200 4.3e-03

AA Sequence

MAALRRLLWPPPRVSPPLCAHQPLLGPWGRPAVTTLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVA      1 - 70
AAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIPVAAAKETVAIGRTDIEDLDL     71 - 140
YATSRERRFRLFASIECEGQLFMTPYDFILAVTTDEPKVAKTWKSLSKQELNQMLAETPPVWKGSSKLFR    141 - 210
NLKEKGVISYTEYLFLLCILTKPHAGFRIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKREIKGDEEKR    211 - 280
AMLRLQLYGYHSPTNSVLKTDAEELVSRSYWDTLRRNTSQALFSDLAERADDITSLVTDTTLLVHFFGKK    281 - 350
GKAELNFEDFYRFMDNLQTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSIPEEKG    351 - 420
ITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKFSPHLVNTVFKIFDVDKDDQL    421 - 490
SYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR                                  491 - 530
//

Text Mined References (5)

PMID Year Title