Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.14
PubTator Score 0.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

AA Sequence

MAALRRLLWPPPRVSPPLCAHQPLLGPWGRPAVTTLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVA      1 - 70
AAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIPVAAAKETVAIGRTDIEDLDL     71 - 140
YATSRERRFRLFASIECEGQLFMTPYDFILAVTTDEPKVAKTWKSLSKQELNQMLAETPPVWKGSSKLFR    141 - 210
NLKEKGVISYTEYLFLLCILTKPHAGFRIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKREIKGDEEKR    211 - 280
AMLRLQLYGYHSPTNSVLKTDAEELVSRSYWDTLRRNTSQALFSDLAERADDITSLVTDTTLLVHFFGKK    281 - 350
GKAELNFEDFYRFMDNLQTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSIPEEKG    351 - 420
ITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKFSPHLVNTVFKIFDVDKDDQL    421 - 490
SYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR                                  491 - 530
//

Text Mined References (5)

PMID Year Title
23409044 2013 MICU2, a paralog of MICU1, resides within the mitochondrial uniporter complex to regulate calcium handling.
22064162 2012 Genome-wide association study of comorbid depressive syndrome and alcohol dependence.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.