Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.62
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 5.68162164822243E-13
osteosarcoma 7933 5.02848608570873E-7
Pick disease 1893 4.71327048271498E-6
acute myeloid leukemia 785 0.00595522163605548
tuberculosis and treatment for 6 months 686 0.00671340459435518
group 3 medulloblastoma 2254 0.00786970081869918

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.778 0.000
tuberculosis and treatment for 6 months 1.400 0.007
group 3 medulloblastoma 1.500 0.008
Pick disease 1.200 0.000
acute myeloid leukemia -1.500 0.006
ovarian cancer -1.100 0.000

Synonym

Accession Q86XD8 A8K8V4 B2RAX2 Q5VVY5
Symbols ANUBL1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
25682742 In gastric cancer cells, ANUBL1 was upregulated and promoted proliferation of SGC-7901 cells. Over-expression decreased miR-182 expression. ANUBL1 expression was in turn directly downregulated by miR-182 in a negative feedback loop.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDNRKEPPFFNDDNMGPFYYRLHFCDTMELFIETLTGTCFELRVSPFETVISVKAKIRRLEGIPICRQHL      1 - 70
IWNNMELENDYCLNDYNISEGCTLKLVLAMRGGPINTRRVPTDDPLRKMAEYLDSSRVEVWEKTSCSKQV     71 - 140
TFLVYQEGDQLNFFPAVDRGDGTLTPLSDSSKKIDFHLHVLRRKGEHRMSGGSMYNSDTDEDEETEPSSS    141 - 210
GQQIIENSITMNKMKLLKAKMKNMNLSKKPKKAVKIKPHPPVAPRPSSGSTAPSRHRLLRVLPNIGQSCS    211 - 280
PAFGNAYPPEISRNGISSLATQLSAERYISSITGEFLKEDNSWENNTLSHFSSNVKLPPQIPHLELGNDQ    281 - 350
ELADSVLHLGSSLPRQTKHFLGNLPSSNGNIVLPSEECVTEQSLLPKVGSLASFAEGNADEQSSGLEGAC    351 - 420
KVNLELLLTNADKGLKAPEQHLKHVAGVLNGESVETSVLNYRELSPHKNRLLSPLRCSAPMSLHNSLVKP    421 - 490
ERQSKCFEFGKLQPSSSQSLDVQNITDSSFSRTTCFQGVKVDSLGKRSDVISKVEARDITEMTNKASKEP    491 - 560
VGCVNNISFLASLAGSTSRNRLQSTRGAGRLQNSGTGLSTNLQHFQEENFRKSSPQLEHTGVFLSTHGVG    561 - 630
MNGNNAAAGKSVGECTTHHLPPVKAPLQTKKKTTNHCFLCGKKTGLASSYECRCGNNFCASHRYAETHGC    631 - 700
TYDYKSAGRRYLHEANPVVNAPKLPKI                                               701 - 727
//

Text Mined References (8)

PMID Year Title
25682742 2015 MicroRNA-182 inhibits proliferation through targeting oncogenic ANUBL1 in gastric cancer.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.