Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.62
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia -1.500 6.0e-03
group 3 medulloblastoma 1.500 7.9e-03
osteosarcoma -2.273 6.3e-09
ovarian cancer -1.100 5.7e-13
Pick disease 1.200 4.7e-06
tuberculosis and treatment for 6 months 1.200 1.5e-04

Gene RIF (2)

AA Sequence

MDNRKEPPFFNDDNMGPFYYRLHFCDTMELFIETLTGTCFELRVSPFETVISVKAKIRRLEGIPICRQHL      1 - 70
IWNNMELENDYCLNDYNISEGCTLKLVLAMRGGPINTRRVPTDDPLRKMAEYLDSSRVEVWEKTSCSKQV     71 - 140
TFLVYQEGDQLNFFPAVDRGDGTLTPLSDSSKKIDFHLHVLRRKGEHRMSGGSMYNSDTDEDEETEPSSS    141 - 210
GQQIIENSITMNKMKLLKAKMKNMNLSKKPKKAVKIKPHPPVAPRPSSGSTAPSRHRLLRVLPNIGQSCS    211 - 280
PAFGNAYPPEISRNGISSLATQLSAERYISSITGEFLKEDNSWENNTLSHFSSNVKLPPQIPHLELGNDQ    281 - 350
ELADSVLHLGSSLPRQTKHFLGNLPSSNGNIVLPSEECVTEQSLLPKVGSLASFAEGNADEQSSGLEGAC    351 - 420
KVNLELLLTNADKGLKAPEQHLKHVAGVLNGESVETSVLNYRELSPHKNRLLSPLRCSAPMSLHNSLVKP    421 - 490
ERQSKCFEFGKLQPSSSQSLDVQNITDSSFSRTTCFQGVKVDSLGKRSDVISKVEARDITEMTNKASKEP    491 - 560
VGCVNNISFLASLAGSTSRNRLQSTRGAGRLQNSGTGLSTNLQHFQEENFRKSSPQLEHTGVFLSTHGVG    561 - 630
MNGNNAAAGKSVGECTTHHLPPVKAPLQTKKKTTNHCFLCGKKTGLASSYECRCGNNFCASHRYAETHGC    631 - 700
TYDYKSAGRRYLHEANPVVNAPKLPKI                                               701 - 727
//

Text Mined References (8)

PMID Year Title