Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.98
PubTator Score 0.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 7.1e-04
astrocytic glioma -1.300 3.4e-03
atypical teratoid / rhabdoid tumor -3.000 3.0e-09
ependymoma -1.900 3.4e-02
glioblastoma -1.100 2.4e-04
group 3 medulloblastoma -2.700 6.1e-06
medulloblastoma, large-cell -3.100 4.4e-06
primitive neuroectodermal tumor -1.100 4.9e-02
subependymal giant cell astrocytoma -2.722 1.9e-02

Gene RIF (1)

AA Sequence

MDSTSSLHGSSLHRPSTEQTRTDFSWDGINLSMEDTTSILPKLKRNSNAYGIGALAKSSFSGISRSMKDH      1 - 70
VTKPTAMGQGRVAHMIEWQGWGKTPAVQPQHSHESVRRDTDAYSDLSDGEKEARFLAGVMEQFAISEATL     71 - 140
MAWSSMDGEDMSVNSTQEPLGCNYSDNYQELMDSQDALAQAPMDGWPHSYVSQGMYCLGSSDAWEASDQS    141 - 210
LIASPATGSYLGPAFDDSQPSLHEMGPSQPASGYSALEPPPLLGGDTDWAPGVGAVDLARGPAEEEKRPL    211 - 280
APEEEEDAGCRDLESLSPREDPEMSTALSRKVSDVTSSGVQSFDEEEGEANN                      281 - 332
//

Text Mined References (13)

PMID Year Title