Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.42
PubTator Score 2.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.300 0.001
group 3 medulloblastoma 1.300 0.000
Pick disease -1.300 0.000
progressive supranuclear palsy -1.100 0.022
ovarian cancer 2.400 0.000

Gene RIF (2)

PMID Text
24626631 METTL23 mutations cause mild nonsyndromic autosomal recessive intellectual disability in two unrelated families, one from Austria, the other from Pakistan.
24501276 METTL23, a transcriptional partner of GABPA, is essential for human cognition

AA Sequence

MYVWPCAVVLAQYLWFHRRSLPGKAILEIGAGVSLPGILAAKCGAEVILSDSSELPHCLEVCRQSCQMNN      1 - 70
LPHLQVVGLTWGHISWDLLALPPQDIILASDVFFEPEDFEDILATIYFLMHKNPKVQLWSTYQVRSADWS     71 - 140
LEALLYKWDMKCVHIPLESFDADKEDIAESTLPGRHTVEMLVISFAKDSL                        141 - 190
//

Text Mined References (8)

PMID Year Title
24626631 2014 Disruption of the methyltransferase-like 23 gene METTL23 causes mild autosomal recessive intellectual disability.
24501276 2014 METTL23, a transcriptional partner of GABPA, is essential for human cognition.
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.