Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.42
PubTator Score 2.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 2.26471715019066E-5
Pick disease 1893 1.46366897421978E-4
group 3 medulloblastoma 2254 4.66131653897707E-4
diabetes mellitus 1663 0.00106283354735609
progressive supranuclear palsy 674 0.0216546714496968
Disease Target Count Z-score Confidence
Intellectual disability 573 3.568 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.300 0.001
group 3 medulloblastoma 1.300 0.000
Pick disease -1.300 0.000
progressive supranuclear palsy -1.100 0.022
ovarian cancer 2.400 0.000

Synonym

Accession Q86XA0 H9ZYJ0 K7EK32
Symbols MRT44
C17orf95

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
24626631 METTL23 mutations cause mild nonsyndromic autosomal recessive intellectual disability in two unrelated families, one from Austria, the other from Pakistan.
24501276 METTL23, a transcriptional partner of GABPA, is essential for human cognition

AA Sequence

MYVWPCAVVLAQYLWFHRRSLPGKAILEIGAGVSLPGILAAKCGAEVILSDSSELPHCLEVCRQSCQMNN      1 - 70
LPHLQVVGLTWGHISWDLLALPPQDIILASDVFFEPEDFEDILATIYFLMHKNPKVQLWSTYQVRSADWS     71 - 140
LEALLYKWDMKCVHIPLESFDADKEDIAESTLPGRHTVEMLVISFAKDSL                        141 - 190
//

Text Mined References (8)

PMID Year Title
24626631 2014 Disruption of the methyltransferase-like 23 gene METTL23 causes mild autosomal recessive intellectual disability.
24501276 2014 METTL23, a transcriptional partner of GABPA, is essential for human cognition.
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.