Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.92
PubTator Score 2.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.300 1.1e-03
group 3 medulloblastoma 1.300 4.7e-04
ovarian cancer -1.300 1.2e-03
Pick disease -1.300 1.5e-04
progressive supranuclear palsy -1.100 2.2e-02

Gene RIF (2)

AA Sequence

MYVWPCAVVLAQYLWFHRRSLPGKAILEIGAGVSLPGILAAKCGAEVILSDSSELPHCLEVCRQSCQMNN      1 - 70
LPHLQVVGLTWGHISWDLLALPPQDIILASDVFFEPEDFEDILATIYFLMHKNPKVQLWSTYQVRSADWS     71 - 140
LEALLYKWDMKCVHIPLESFDADKEDIAESTLPGRHTVEMLVISFAKDSL                        141 - 190
//

Text Mined References (8)

PMID Year Title