Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.08
PubTator Score 207.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.6e-05
osteosarcoma 7950 1.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.201 1.6e-04
psoriasis -2.000 3.6e-05

 GWAS Trait (1)

Protein-protein Interaction (9)

Gene RIF (1)

AA Sequence

MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMGDERVKNGLNF      1 - 70
MYEAPPGAKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFGIQVRNVRCIKCHKWGHVNTD     71 - 140
RECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEGEEDPEV    141 - 210
EFLKSLTTKQKQKLLRKLDRLEKKKKKKDRKKKKFQKSRSKHKKHKSSSSSSSSSSSSSSTETSESSSES    211 - 280
ESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKW    281 - 350
SHSDSDKKSRTHKHSPEKRGSERKEGSSRSHGREERSRRSRSRSPGSYKQRETRKRAQRNPGEEQSRRND    351 - 420
SRSHGTDLYRGEKMYREHPGGTHTKVTQRE                                            421 - 450
//

Text Mined References (22)

PMID Year Title