Property Summary

NCBI Gene PubMed Count 15
Grant Count 96
R01 Count 52
Funding $30,888,311.57
PubMed Score 2.08
PubTator Score 207.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
psoriasis 6,683

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -2.000 0.000
osteosarcoma -1.201 0.000

Synonym

Gene

Gene RIF (1)

PMID Text
15652350 identified as a PAP-1 binding protein and as a splicing factor

AA Sequence

MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMGDERVKNGLNF      1 - 70
MYEAPPGAKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFGIQVRNVRCIKCHKWGHVNTD     71 - 140
RECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEGEEDPEV    141 - 210
EFLKSLTTKQKQKLLRKLDRLEKKKKKKDRKKKKFQKSRSKHKKHKSSSSSSSSSSSSSSTETSESSSES    211 - 280
ESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKW    281 - 350
SHSDSDKKSRTHKHSPEKRGSERKEGSSRSHGREERSRRSRSRSPGSYKQRETRKRAQRNPGEEQSRRND    351 - 420
SRSHGTDLYRGEKMYREHPGGTHTKVTQRE                                            421 - 450
//

Publication (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20873783 2010 Characterization of hNek6 interactome reveals an important role for its short N-terminal domain and colocalization with proteins at the centrosome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19409814 2009 NKAP is a transcriptional repressor of notch signaling and is required for T cell development.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18663143 2008 Slug is a direct Notch target required for initiation of cardiac cushion cellularization.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...