Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
pediatric high grade glioma 2712 3.04712298999271E-7
glioblastoma 5572 6.75326689214307E-6
atypical teratoid / rhabdoid tumor 4369 1.73199116050605E-5
primitive neuroectodermal tumor 3031 6.82136678384121E-5
diabetes mellitus 1663 0.00104821351867176
osteosarcoma 7933 0.00256836017170194
ovarian cancer 8492 0.00601379358609864
Breast cancer 3099 0.0270162221104319

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.003 0.003
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.200 0.000
primitive neuroectodermal tumor 1.100 0.000
diabetes mellitus -1.200 0.001
Breast cancer 3.000 0.027
pediatric high grade glioma 1.200 0.000
ovarian cancer 1.500 0.006

Synonym

Accession Q86X83 Q561V4 Q9H3L5 Q9Y5V1
Symbols HSPC042

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

AA Sequence

MLLELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQHGVEGLTYLLT      1 - 70
ESSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTILSELAPSLPSYHNLEWRLDVQLASRSL     71 - 140
RQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALEEMKTNHCRRVVRNIK               141 - 199
//

Text Mined References (14)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25355947 2015 COMMD1 is linked to the WASH complex and regulates endosomal trafficking of the copper transporter ATP7A.
23637203 2013 Functional interaction of COMMD3 and COMMD9 with the epithelial sodium channel.
23563313 2013 CCDC22 deficiency in humans blunts activation of proinflammatory NF-?B signaling.
21778237 2011 COMMD1 (copper metabolism MURR1 domain-containing protein 1) regulates Cullin RING ligases by preventing CAND1 (Cullin-associated Nedd8-dissociated protein 1) binding.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15799966 2005 COMMD proteins, a novel family of structural and functional homologs of MURR1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...