Property Summary

NCBI Gene PubMed Count 11
Grant Count 6
R01 Count 3
Funding $572,015.41
PubMed Score 157.11
PubTator Score 14.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.835 0.000
tuberculosis and treatment for 6 months -1.100 0.006
group 3 medulloblastoma 1.200 0.020
ovarian cancer 1.200 0.000

Gene RIF (4)

PMID Text
25008847 Human NIT1/2 are not involved in the metabolism of vildagliptin.
22082156 Knockdown of nitrilase 1 (NIT1) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20877624 Observational study of gene-disease association. (HuGE Navigator)
16864578 Nit1 and Fhit share tumor suppressor signaling pathways, while localization of the NIT1 gene at a stable chromosome site explains the paucity of gene alterations and in frequent loss of expression of the NIT1 gene in human malignancies.

AA Sequence

MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQPRPRAMAISSSSCELPLVAVCQVTSTPDKQQNFKTCAEL      1 - 70
VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLARECGLWLSLGGFHERGQDWEQTQ     71 - 140
KIYNCHVLLNSKGAVVATYRKTHLCDVEIPGQGPMCESNSTMPGPSLESPVSTPAGKIGLAVCYDMRFPE    141 - 210
LSLALAQAGAEILTYPSAFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGT    211 - 280
VVARCSEGPGLCLARIDLNYLRQLRRHLPVFQHRRPDLYGNLGHPLS                           281 - 327
//

Publication (14)

PMID Year Title
25008847 2014 Human nitrilase-like protein does not catalyze the hydrolysis of vildagliptin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16864578 2006 Biological functions of mammalian Nit1, the counterpart of the invertebrate NitFhit Rosetta stone protein, a possible tumor suppressor.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...