Property Summary

NCBI Gene PubMed Count 3
Grant Count 43
R01 Count 20
Funding $5,264,512.23
PubMed Score 0.11
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
26206078 An epistemological characterization of the human tumorigenic neuronal paralogous FAM72 gene loci (FAM72A, FAM72B, FAM72C, FAM72D).
19755123 this study provides an additional possible mechanism of neurotoxicity in Alzheimer's disease, the induction of p17(FAM72B), through which Abeta acts to induce apoptosis and exhibit other Alzheimer's disease characteristics.

AA Sequence

MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLK      1 - 70
DIACLKCGNIVGYHVIVPCSSCLPSCNNGHFWMFHSQAVYDINRLDSTGVNILLWGNLPEIEESTDEDVL     71 - 140
NISAEECIR                                                                 141 - 149
//

Text Mined References (5)

PMID Year Title
26206078 2015 All-or-(N)One - an epistemological characterization of the human tumorigenic neuronal paralogous FAM72 gene loci.
19755123 2009 Identification and characterisation of the novel amyloid-beta peptide-induced protein p17.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.