Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.11
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLK      1 - 70
DIACLKCGNIVGYHVIVPCSSCLPSCNNGHFWMFHSQAVYDINRLDSTGVNILLWGNLPEIEESTDEDVL     71 - 140
NISAEECIR                                                                 141 - 149
//

Text Mined References (5)

PMID Year Title