Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q86X59
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGRPLEGQPLRALDLYPEPAFLRSGKDPKSSPASSPSFAVLGPEVRSTGGQAGSRRRPSAPCSQDRAAAE      1 - 70
GAPALLGGSPSSGSPGHPPGSAFGVEAGCRALNVSEHARGGFALGLPFGLSGGAYLFLLLDGAGDPKPTP     71 - 140
EAPISSADGRAWFPSESSWQLPQLPAGSTSGSEPRARPGLGPRQLLTGPRDGAAGQGPGRGLTARLGRER    141 - 210
EIDCGPRQAGHGGTATDTGRAGSGARHRPPRDRGTPGLRTH                                 211 - 251
//

Publication (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.