Property Summary

NCBI Gene PubMed Count 88
Grant Count 111
R01 Count 69
Funding $8,298,445.98
PubMed Score 118.44
PubTator Score 113.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.300 0.000
osteosarcoma -1.527 0.006
non-small cell lung cancer 1.001 0.000
ovarian cancer 1.400 0.000

Synonym

Accession Q86X55 A6NN38
Symbols PRMT4

Gene

PANTHER Protein Class (2)

PDB

2Y1W   2Y1X   4IKP   5DWQ   5DX0   5DX1   5DX8   5DXA   5DXJ  

Protein-protein Interaction (3)

Gene RIF (54)

PMID Text
26848779 Monitoring of the CARM1-dependent production of monomethylated and dimethylated peptides over time by self-assembled monolayer and matrix-assisted laser desorption ionization mass spectrometry revealed that methylation by CARM1 is distributive.
26656492 CARM1 associates with major nonsense-mediated mRNA decay factor UPF1 and promotes its occupancy on premature terminating codon-containing transcripts in spinal muscular atrophy.
26030442 no obvious association of CARM1 isoform expression and clinical correlates in breast cancer
25934150 Like insulin, CARM1 overexpression increased CDK2 and CDK4 expression. In addition, CARM1 knockdown reduced the number of insulin-induced G2/M phase cells
25792598 disruption of CARM1 enhances the nuclear retention of mRNAs containing IRAlus
25585345 O-GlcNAcylation of CARM1 at its C-terminus is an important determinant for CARM1 substrate specificity.
25392304 Data indicate that coactivator-associated arginine methyltransferase 1 (CARM1) regulates neural differentiation through Nanog homeobox protein and microRNA miR92a.
25348716 PRMT4 has a role in arginine methylation, which negatively regulates retinoblastoma tumor suppressor protein and promotes E2F-1 dissociation
25072916 high-glucose-induced CARM1 expression increases RPE cell apoptosis via H3R17 asymmetric dimethylation
25064859 a noncoding variant in the CARM1-promoter functions as a regulator of gene transcription and homocysteine levels
More...

AA Sequence

MAAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLEVRAGPDSAGIA      1 - 70
LYSHEDVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSFYNILKTCRGHTLERSVFSER     71 - 140
TEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKI    141 - 210
YAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLK    211 - 280
PSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMA    281 - 350
KSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRC    351 - 420
LFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPPGSHYT    421 - 490
SPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLANTGIVNHTHSRMGSIMSTGIV    491 - 560
QGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNTMHYGS                          561 - 608
//

Publication (94)

PMID Year Title
26848779 2016 CARM1 Preferentially Methylates H3R17 over H3R26 through a Random Kinetic Mechanism.
26656492 2016 A novel role for CARM1 in promoting nonsense-mediated mRNA decay: potential implications for spinal muscular atrophy.
26267537 2015 Characterization of a Steroid Receptor Coactivator Small Molecule Stimulator that Overstimulates Cancer Cells and Leads to Cell Stress and Death.
26030442 2015 Differential CARM1 Isoform Expression in Subcellular Compartments and among Malignant and Benign Breast Tumors.
25934150 2015 Insulin-induced CARM1 upregulation facilitates hepatocyte proliferation.
25792598 2015 Protein arginine methyltransferase CARM1 attenuates the paraspeckle-mediated nuclear retention of mRNAs containing IRAlus.
25585345 2015 O-GlcNAcylation of co-activator-associated arginine methyltransferase 1 regulates its protein substrate specificity.
25392304 2015 CARM1 regulates astroglial lineage through transcriptional regulation of Nanog and posttranscriptional regulation by miR92a.
25348716 2015 PRMT4-mediated arginine methylation negatively regulates retinoblastoma tumor suppressor protein and promotes E2F-1 dissociation.
25072916 2014 High-glucose-induced CARM1 expression regulates apoptosis of human retinal pigment epithelial cells via histone 3 arginine 17 dimethylation: role in diabetic retinopathy.
More...