Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.38
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma -1.200 2.9e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.7e-02
osteosarcoma -2.005 4.5e-07
ovarian cancer 1.100 3.6e-09

Synonym

Accession Q86X53 A8K2J9 Q9P063
Symbols HSPC319

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAAHRKHVFVEKVLQRLFPPVPSGQGKREPQTLAVQNPPKKVTSEKVSQKHAEPLTDTGSETPTARRLYT      1 - 70
ASGPPEGYVPCWPEPSSCGSPENASSGDDTEDQDPHDQPKRRRIRKHKSKKKFKNPNNVLIEQAELEKQQ     71 - 140
SLLQEKSQRQHTDGTTISKNKKRKLKKKQQIKRKKAAGLAAKAAGVSFMYQPEDSSNEGEGVGEACEEDG    141 - 210
VDTSEEDPTLAGEEDVKDTREEDGADASEEDLTRARQEEGADASEEDPTPAGEEDVKDAREEDGVDTIEE    211 - 280
DLTRAGEEDGKDTREEDGADASEEDPTWAGEEEGADSGEEDGADASEEDDTITNEKAHSILNFLKSTQEM    281 - 350
YFYDGVSRDAASAALADAAEELLDRLASHSMLPSDVSILYHMKTLLLLQDTERLKHALEMFPEHCTMPPD    351 - 420
HARVISAFFSYWITHILPEKSSD                                                   421 - 443
//

Text Mined References (12)

PMID Year Title