Property Summary

NCBI Gene PubMed Count 19
PubMed Score 48.54
PubTator Score 31.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 1.144 1.8e-02
acute quadriplegic myopathy 1.043 3.9e-06
dermatomyositis 1.800 2.2e-03
ependymoma 1.100 5.0e-06
fibroadenoma 1.100 5.2e-03
glioblastoma 1.900 2.8e-04
juvenile dermatomyositis 1.566 4.0e-15
lung adenocarcinoma -1.100 1.2e-06
medulloblastoma 1.100 4.1e-04
Multiple myeloma 1.069 3.1e-03
ovarian cancer 1.600 1.4e-03
pancreatic cancer 2.100 8.0e-03
pituitary cancer -1.500 2.0e-06
primary pancreatic ductal adenocarcinoma 1.967 1.2e-02
ulcerative colitis 1.800 4.7e-07

Gene RIF (8)

AA Sequence

MAARGRRAWLSVLLGLVLGFVLASRLVLPRASELKRAGPRRRASPEGCRSGQAAASQAGGARGDARGAQL      1 - 70
WPPGSDPDGGPRDRNFLFVGVMTAQKYLQTRAVAAYRTWSKTIPGKVQFFSSEGSDTSVPIPVVPLRGVD     71 - 140
DSYPPQKKSFMMLKYMHDHYLDKYEWFMRADDDVYIKGDRLENFLRSLNSSEPLFLGQTGLGTTEEMGKL    141 - 210
ALEPGENFCMGGPGVIMSREVLRRMVPHIGKCLREMYTTHEDVEVGRCVRRFAGVQCVWSYEMQQLFYEN    211 - 280
YEQNKKGYIRDLHNSKIHQAITLHPNKNPPYQYRLHSYMLSRKISELRHRTIQLHREIVLMSKYSNTEIH    281 - 350
KEDLQLGIPPSFMRFQPRQREEILEWEFLTGKYLYSAVDGQPPRRGMDSAQREALDDIVMQVMEMINANA    351 - 420
KTRGRIIDFKEIQYGYRRVNPMYGAEYILDLLLLYKKHKGKKMTVPVRRHAYLQQTFSKIQFVEHEELDA    421 - 490
QELAKRINQESGSLSFLSNSLKKLVPFQLPGSKSEHKEPKDKKINILIPLSGRFDMFVRFMGNFEKTCLI    491 - 560
PNQNVKLVVLLFNSDSNPDKAKQVELMRDYRIKYPKADMQILPVSGEFSRALALEVGSSQFNNESLLFFC    561 - 630
DVDLVFTTEFLQRCRANTVLGQQIYFPIIFSQYDPKIVYSGKVPSDNHFAFTQKTGFWRNYGFGITCIYK    631 - 700
GDLVRVGGFDVSIQGWGLEDVDLFNKVVQAGLKTFRSQEVGVVHVHHPVFCDPNLDPKQYKMCLGSKAST    701 - 770
YGSTQQLAEMWLEKNDPSYSKSSNNNGSVRTA                                          771 - 802
//

Text Mined References (20)

PMID Year Title