Property Summary

NCBI Gene PubMed Count 18
PubMed Score 19.22
PubTator Score 7.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
chronic rhinosinusitis -1.359 2.4e-02
colon cancer 1.100 1.0e-02
cystic fibrosis and chronic rhinosinusit... -1.182 3.6e-02
ependymoma 1.600 4.4e-08
medulloblastoma -1.100 2.5e-04
medulloblastoma, large-cell -1.100 5.9e-03
nasopharyngeal carcinoma -1.300 9.4e-07
osteosarcoma -1.568 4.2e-04

Gene RIF (3)

AA Sequence

MGWITEDLIRRNAEHNDCVIFSLEELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIENVSKLKKLEY      1 - 70
LNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQHNIHLKELFLMGNPCASFDHYREFVVATLP     71 - 140
QLKWLDGKEIEPSERIKALQDYSVIEPQIREQEKDHCLKRAKLKEEAQRKHQEEDKNEDKRSNAGFDGRW    141 - 210
YTDINATLSSLESKDHLQAPDTEEHNTKKLDNSEDDLEFWNKPCLFTPESRLETLRHMEKQRKKQEKLSE    211 - 280
KKKKVKPPRTLITEDGKALNVNEPKIDFSLKDNEKQIILDLAVYRYMDTSLIDVDVQPTYVRVMIKGKPF    281 - 350
QLVLPAEVKPDSSSAKRSQTTGHLVICMPKVGEVITGGQRAFKSMKTTSDRSREQTNTRSKHMEKLEVDP    351 - 420
SKHSFPDVTNIVQEKKHTPRRRPEPKIIPSEEDPTFEDNPEVPPLI                            421 - 466
//

Text Mined References (17)

PMID Year Title