Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.79
PubTator Score 0.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 2.3e-07
posterior fossa group B ependymoma 416 1.1e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 2.3e-07
posterior fossa group B ependymoma 1.300 1.1e-05

AA Sequence

MASELCKTISVARLEKHKNLFLNYRNLHHFPLELLKDEGLQYLERLYMKRNSLTSLPENLAQKLPNLVEL      1 - 70
YLHSNNIVVVPEAIGSLVKLQCLDLSDNALEIVCPEIGRLRALRHLRLANNQLQFLPPEVGDLKELQTLD     71 - 140
ISTNRLLTLPERLHMCLSLQYLTVDRNRLWYVPRHLCQLPSLNELSMAGNRLAFLPLDLGRSRELQYVYV    141 - 210
DNNIHLKGLPSYLYNKVIGCSGCGAPIQVSEVKLLSFSSGQRTVFLPAEVKAIGTEHDHVLPLQELAMRG    211 - 280
LYHTYHSLLKDLNFLSPISLPRSLLELLHCPLGHCHRCSEPMFTIVYPKLFPLRETPMAGLHQWKTTVSF    281 - 350
VAYCCSTQCLQTFDLLS                                                         351 - 367
//

Text Mined References (8)

PMID Year Title