Property Summary

NCBI Gene PubMed Count 19
Grant Count 8
Funding $1,708,021
PubMed Score 75.49
PubTator Score 20.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (5)

PMID Text
25882847 analysis of how Clostridium difficile binary toxin CDT interacts with its host cell receptor, Lipolysis-stimulated Lipoprotein Receptor
23631918 These data show that Clostridium difficile binary toxin CDT induces clustering of the lipolysis-stimulated lipoprotein receptor into lipid rafts.
22252869 findings show that Clostridium spiroforme toxin (CST)enters target cells via the lipolysis-stimulated lipoprotein receptor; findings indicate that CST shares LSR with C. difficile CDT and C. perfringens iota toxin as a host cell surface receptor
21245199 LSR defines tricellular contacts in epithelial cellular sheets by acting as a landmark to recruit tricellulin for tricellular tight junction formation.
17975147 LISCH7 may have a role in progression of human colon cancer

AA Sequence

MQQDGLGVGTRNGSGKGRSVHPSWPWCAPRPLRYFGRDARARRAQTAAMALLAGGLSRGLGSHPAAAGRD      1 - 70
AVVFVWLLLSTWCTAPARAIQVTVSNPYHVVILFQPVTLPCTYQMTSTPTQPIVIWKYKSFCRDRIADAF     71 - 140
SPASVDNQLNAQLAAGNPGYNPYVECQDSVRTVRVVATKQGNAVTLGDYYQGRRITITGNADLTFDQTAW    141 - 210
GDSGVYYCSVVSAQDLQGNNEAYAELIVLGRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGIC    211 - 280
WCQCCPHTCCCYVRCPCCPDKCCCPEALYAAGKAATSGVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYN    281 - 350
GYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSMRVLYYMEKELANFDPSRP    351 - 420
GPPSGRVERAMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPR    421 - 490
ARSVDALDDLTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDSRDFPRSRDPHYDDFRSRERP    491 - 560
PADPRSHHHRTRDPRDNGSRSGDLPYDGRLLEEAVRKKGSEERRRPHKEEEEEAYYPPAPPPYSETDSQA    561 - 630
SRERRLKKNLALSRESLVV                                                       631 - 649
//

Publication (27)

PMID Year Title
25882847 2015 Interaction of the Clostridium difficile Binary Toxin CDT and Its Host Cell Receptor, Lipolysis-stimulated Lipoprotein Receptor (LSR).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23631918 2013 Clostridium difficile binary toxin CDT induces clustering of the lipolysis-stimulated lipoprotein receptor into lipid rafts.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22252869 2012 Identification of the cellular receptor of Clostridium spiroforme toxin.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21245199 2011 LSR defines cell corners for tricellular tight junction formation in epithelial cells.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
More...