Property Summary

NCBI Gene PubMed Count 19
PubMed Score 75.49
PubTator Score 20.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 1.83826998654995E-10
lung adenocarcinoma 2714 1.52906600604536E-7
malignant mesothelioma 3163 5.79168417377931E-7
posterior fossa group A ependymoma 1511 7.98662802016167E-5
tuberculosis 1563 9.65345574565774E-5
lung cancer 4473 0.0010526282485177
pancreatic cancer 2300 0.00152441963034946
ductal carcinoma in situ 1745 0.00158245746077917
invasive ductal carcinoma 2950 0.00159117782753105
Multiple myeloma 1328 0.00299416161618599
atypical teratoid / rhabdoid tumor 4369 0.00608225430580484
inflammatory breast cancer 404 0.012041368920281
esophageal adenocarcinoma 737 0.0480438108206358
Disease Target Count Z-score Confidence
Clostridium difficile colitis 12 4.011 2.0
Paragonimiasis 9 3.352 1.7

Expression

  Differential Expression (13)

Synonym

Accession Q86X29 A6NDW3 B4DKL4 E9PHD4 O00112 O00426 Q6ZT80 Q8NBM0 Q9BT33 Q9UQL3
Symbols ILDR3
LISCH7

Gene

LSR

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA Inparanoid

Gene RIF (5)

PMID Text
25882847 analysis of how Clostridium difficile binary toxin CDT interacts with its host cell receptor, Lipolysis-stimulated Lipoprotein Receptor
23631918 These data show that Clostridium difficile binary toxin CDT induces clustering of the lipolysis-stimulated lipoprotein receptor into lipid rafts.
22252869 findings show that Clostridium spiroforme toxin (CST)enters target cells via the lipolysis-stimulated lipoprotein receptor; findings indicate that CST shares LSR with C. difficile CDT and C. perfringens iota toxin as a host cell surface receptor
21245199 LSR defines tricellular contacts in epithelial cellular sheets by acting as a landmark to recruit tricellulin for tricellular tight junction formation.
17975147 LISCH7 may have a role in progression of human colon cancer

AA Sequence

MQQDGLGVGTRNGSGKGRSVHPSWPWCAPRPLRYFGRDARARRAQTAAMALLAGGLSRGLGSHPAAAGRD      1 - 70
AVVFVWLLLSTWCTAPARAIQVTVSNPYHVVILFQPVTLPCTYQMTSTPTQPIVIWKYKSFCRDRIADAF     71 - 140
SPASVDNQLNAQLAAGNPGYNPYVECQDSVRTVRVVATKQGNAVTLGDYYQGRRITITGNADLTFDQTAW    141 - 210
GDSGVYYCSVVSAQDLQGNNEAYAELIVLGRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGIC    211 - 280
WCQCCPHTCCCYVRCPCCPDKCCCPEALYAAGKAATSGVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYN    281 - 350
GYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSMRVLYYMEKELANFDPSRP    351 - 420
GPPSGRVERAMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPR    421 - 490
ARSVDALDDLTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDSRDFPRSRDPHYDDFRSRERP    491 - 560
PADPRSHHHRTRDPRDNGSRSGDLPYDGRLLEEAVRKKGSEERRRPHKEEEEEAYYPPAPPPYSETDSQA    561 - 630
SRERRLKKNLALSRESLVV                                                       631 - 649
//

Text Mined References (27)

PMID Year Title
25882847 2015 Interaction of the Clostridium difficile Binary Toxin CDT and Its Host Cell Receptor, Lipolysis-stimulated Lipoprotein Receptor (LSR).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23631918 2013 Clostridium difficile binary toxin CDT induces clustering of the lipolysis-stimulated lipoprotein receptor into lipid rafts.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22252869 2012 Identification of the cellular receptor of Clostridium spiroforme toxin.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21245199 2011 LSR defines cell corners for tricellular tight junction formation in epithelial cells.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
More...