Property Summary

NCBI Gene PubMed Count 21
PubMed Score 81.78
PubTator Score 20.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.700 6.1e-03
ductal carcinoma in situ 2.000 1.6e-03
esophageal adenocarcinoma 1.500 4.8e-02
inflammatory breast cancer 1.100 1.2e-02
invasive ductal carcinoma 2.500 1.6e-03
lung adenocarcinoma 1.200 4.2e-05
lung cancer 1.200 1.1e-03
malignant mesothelioma 2.200 5.8e-07
Multiple myeloma 1.248 3.0e-03
non-small cell lung cancer 1.103 1.8e-10
pancreatic cancer 1.200 1.5e-03
posterior fossa group A ependymoma 1.100 8.0e-05
tuberculosis -1.400 9.7e-05

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (7)

AA Sequence

MQQDGLGVGTRNGSGKGRSVHPSWPWCAPRPLRYFGRDARARRAQTAAMALLAGGLSRGLGSHPAAAGRD      1 - 70
AVVFVWLLLSTWCTAPARAIQVTVSNPYHVVILFQPVTLPCTYQMTSTPTQPIVIWKYKSFCRDRIADAF     71 - 140
SPASVDNQLNAQLAAGNPGYNPYVECQDSVRTVRVVATKQGNAVTLGDYYQGRRITITGNADLTFDQTAW    141 - 210
GDSGVYYCSVVSAQDLQGNNEAYAELIVLGRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGIC    211 - 280
WCQCCPHTCCCYVRCPCCPDKCCCPEALYAAGKAATSGVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYN    281 - 350
GYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSMRVLYYMEKELANFDPSRP    351 - 420
GPPSGRVERAMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPR    421 - 490
ARSVDALDDLTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDSRDFPRSRDPHYDDFRSRERP    491 - 560
PADPRSHHHRTRDPRDNGSRSGDLPYDGRLLEEAVRKKGSEERRRPHKEEEEEAYYPPAPPPYSETDSQA    561 - 630
SRERRLKKNLALSRESLVV                                                       631 - 649
//

Text Mined References (29)

PMID Year Title