Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.43
PubTator Score 0.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Atopic dermatitis 1.200 9.2e-04
ductal carcinoma in situ 1.800 1.3e-03
ependymoma 1.200 3.2e-02
group 3 medulloblastoma 2.900 9.1e-08
intraductal papillary-mucinous adenoma (... 1.500 3.5e-03
intraductal papillary-mucinous carcinoma... 1.700 3.5e-03
intraductal papillary-mucinous neoplasm ... 1.900 7.0e-03
invasive ductal carcinoma 1.500 1.3e-02
lung adenocarcinoma 1.300 2.2e-11
lung cancer 1.100 1.1e-02
medulloblastoma, large-cell 1.400 1.9e-02
nasopharyngeal carcinoma -1.300 1.2e-02
non primary Sjogren syndrome sicca -1.100 2.6e-02
non-small cell lung cancer 1.570 9.1e-24
osteosarcoma -2.455 3.1e-03
ovarian cancer -1.300 9.1e-04
pancreatic ductal adenocarcinoma liver m... -1.026 9.8e-03
psoriasis 1.100 2.3e-30
pulmonary arterial hypertension 2.600 4.5e-02
spina bifida -2.294 4.0e-02
tuberculosis 1.300 6.3e-04
urothelial carcinoma -1.100 3.5e-03

Gene RIF (1)

AA Sequence

MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTPEEYAGQITLMDVPVFKAIQP      1 - 70
DELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEVLSHYIKTAKKLYELNNLHAL     71 - 140
MAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKEDNYKRLRDYISSLKMTPCIPYLGIYLSDLT    141 - 210
YIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDIPMLPHVQKYLNSVQYIEELQKFVEDDNYKL    211 - 280
SLKIEPGTSTPRSAASREDLVGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIH    281 - 350
KMNTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWPAFERNRLY    351 - 420
HSLGPVTRVARNGYRSHMKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKEGKKPTVASWTKYWAALCG    421 - 490
TQLFYYAAKSLKATERKHFKSTSNKNVSVIGWMVMMADDPEHPDLFLLTDSEKGNSYKFQAGNRMNAMLW    491 - 560
FKHLSAACQSNKQQVPTNLMTFE                                                   561 - 583
//

Text Mined References (18)

PMID Year Title