Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.01
PubTator Score 0.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.3425524670982E-30
non-small cell lung cancer 2798 9.12827531781123E-24
lung adenocarcinoma 2714 2.21816424861421E-11
posterior fossa group B ependymoma 1530 1.09589365259042E-10
group 3 medulloblastoma 2254 9.14560696895994E-8
primary Sjogren syndrome 789 3.16962799155868E-4
ovarian cancer 8492 4.49054098539636E-4
primary pancreatic ductal adenocarcinoma 1271 5.99732077250754E-4
ductal carcinoma in situ 1745 0.00128096346073843
nasopharyngeal carcinoma 1056 0.00242640990242082
osteosarcoma 7933 0.00305131646825166
urothelial carcinoma 318 0.00345106080936095
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0034717491720104
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00353868791258825
tuberculosis and treatment for 3 months 327 0.00452399792646141
medulloblastoma, large-cell 6234 0.00516208240822799
Atopic dermatitis 944 0.0057170215963683
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00698215607182111
invasive ductal carcinoma 2950 0.00718581719441817
lung cancer 4473 0.0108471981883689
spina bifida 1064 0.0398657641750647
pulmonary arterial hypertension 36 0.0447930564683464
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 4.0

Expression

Synonym

Accession Q86X27 B7Z7B1 Q5T5Z1 Q5VZ67 Q9NW78
Symbols dJ595C2.1

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid

AA Sequence

MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTPEEYAGQITLMDVPVFKAIQP      1 - 70
DELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEVLSHYIKTAKKLYELNNLHAL     71 - 140
MAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKEDNYKRLRDYISSLKMTPCIPYLGIYLSDLT    141 - 210
YIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDIPMLPHVQKYLNSVQYIEELQKFVEDDNYKL    211 - 280
SLKIEPGTSTPRSAASREDLVGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIH    281 - 350
KMNTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWPAFERNRLY    351 - 420
HSLGPVTRVARNGYRSHMKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKEGKKPTVASWTKYWAALCG    421 - 490
TQLFYYAAKSLKATERKHFKSTSNKNVSVIGWMVMMADDPEHPDLFLLTDSEKGNSYKFQAGNRMNAMLW    491 - 560
FKHLSAACQSNKQQVPTNLMTFE                                                   561 - 583
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17564960 2007 A genomewide screen for late-onset Alzheimer disease in a genetically isolated Dutch population.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...