Property Summary

NCBI Gene PubMed Count 17
PubMed Score 27.91
PubTator Score 10.10

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
cystic fibrosis 1.900 6.7e-06
lung adenocarcinoma 1.500 1.1e-04
lung carcinoma -1.400 2.7e-17
mucosa-associated lymphoid tissue lympho... 1.139 9.4e-03
non primary Sjogren syndrome sicca -1.400 2.6e-02
non-small cell lung cancer 2.129 2.1e-10
psoriasis 1.300 1.1e-02

Gene RIF (4)

AA Sequence

MATAQLQRTPMSALVFPNKISTEHQSLVLVKRLLAVSVSCITYLRGIFPECAYGTRYLDDLCVKILREDK      1 - 70
NCPGSTQLVKWMLGCYDALQKKYLRMVVLAVYTNPEDPQTISECYQFKFKYTNNGPLMDFISKNQSNESS     71 - 140
MLSTDTKKASILLIRKIYILMQNLGPLPNDVCLTMKLFYYDEVTPPDYQPPGFKDGDCEGVIFEGEPMYL    141 - 210
NVGEVSTPFHIFKVKVTTERERMENIDSTILSPKQIKTPFQKILRDKDVEDEQEHYTSDDLDIETKMEEQ    211 - 280
EKNPASSELEEPSLVCEEDEIMRSKESPDLSISHSQVEQLVNKTSELDMSESKTRSGKVFQNKMANGNQP    281 - 350
VKSSKENRKRSQHESGRIVLHHFDSSSQESVPKRRKFSEPKEHI                              351 - 394
//

Text Mined References (19)

PMID Year Title