Property Summary

NCBI Gene PubMed Count 17
PubMed Score 27.63
PubTator Score 10.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.66607716312672E-17
non-small cell lung cancer 2798 2.06504135916275E-10
psoriasis 6685 2.70517330063674E-7
cystic fibrosis 1670 6.70914527417543E-6
lung adenocarcinoma 2714 1.06248945969525E-4
mucosa-associated lymphoid tissue lymphoma 480 0.00939557713607225
non primary Sjogren syndrome sicca 840 0.0259625325698846
Disease Target Count Z-score Confidence
Splenic infarction 6 3.447 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
non-small cell lung cancer 2.129 0.000
cystic fibrosis 1.900 0.000
lung adenocarcinoma 1.500 0.000
non primary Sjogren syndrome sicca -1.400 0.026
psoriasis 2.000 0.000
lung carcinoma -1.400 0.000
mucosa-associated lymphoid tissue lympho... 1.139 0.009

Synonym

Accession Q86X24 A6NMK2 B3KUK1 Q4G114 Q5T5I3 Q5T5I4 Q5T5I5 Q6FIC1 Q9H0K8
Symbols CT46
NOHMA

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid

Gene RIF (4)

PMID Text
25770156 Genomic Complexity Profiling Reveals That HORMAD1 Overexpression Contributes to Homologous Recombination Deficiency in Triple-Negative Breast Cancers
24803422 Hormad1 and Hormad2 might not be the susceptible genes for the non-obstructive azoospermia in our study population. However, rs718772 of Hormad2 variant might be associated with testis development in NOA patients.
22776561 HORMAD1 gene silencing resulted in significantly reduced VEGF protein levels and microvessel density compared to controls in epithelial ovarian carcinoma.
22407170 This is the first report showing that HORMAD1 single-nucleotide polymorphisms (SNPs) may predispose men to a defect in spermatogenesis, although the causal and potential mechanistic relationships between these HORMAD1 SNPs and azoospermia remain unclear.

AA Sequence

MATAQLQRTPMSALVFPNKISTEHQSLVLVKRLLAVSVSCITYLRGIFPECAYGTRYLDDLCVKILREDK      1 - 70
NCPGSTQLVKWMLGCYDALQKKYLRMVVLAVYTNPEDPQTISECYQFKFKYTNNGPLMDFISKNQSNESS     71 - 140
MLSTDTKKASILLIRKIYILMQNLGPLPNDVCLTMKLFYYDEVTPPDYQPPGFKDGDCEGVIFEGEPMYL    141 - 210
NVGEVSTPFHIFKVKVTTERERMENIDSTILSPKQIKTPFQKILRDKDVEDEQEHYTSDDLDIETKMEEQ    211 - 280
EKNPASSELEEPSLVCEEDEIMRSKESPDLSISHSQVEQLVNKTSELDMSESKTRSGKVFQNKMANGNQP    281 - 350
VKSSKENRKRSQHESGRIVLHHFDSSSQESVPKRRKFSEPKEHI                              351 - 394
//

Text Mined References (19)

PMID Year Title
25770156 2015 Genomic Complexity Profiling Reveals That HORMAD1 Overexpression Contributes to Homologous Recombination Deficiency in Triple-Negative Breast Cancers.
24803422 2014 Genetic study of Hormad1 and Hormad2 with non-obstructive azoospermia patients in the male Chinese population.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
22776561 2013 Biological significance of HORMA domain containing protein 1 (HORMAD1) in epithelial ovarian carcinoma.
22407170 2012 Single-nucleotide polymorphisms in HORMAD1 may be a risk factor for azoospermia caused by meiotic arrest in Japanese patients.
18089785 2007 Integrated profiling of basal and luminal breast cancers.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
16331256 2006 Systematic search for gastric cancer-specific genes based on SAGE data: melanoma inhibitory activity and matrix metalloproteinase-10 are novel prognostic factors in patients with gastric cancer.
More...