Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.56
PubTator Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Gastrointestinal Stromal Tumors 48 0.0 0.0
Disease Target Count
OROFACIODIGITAL SYNDROME VI 8
Disease Target Count P-value
lung carcinoma 2843 4.2e-21
ependymoma 4679 5.5e-07
ovarian cancer 8519 3.3e-05
astrocytic glioma 2597 1.8e-02
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Disease Target Count Z-score Confidence
Meckel syndrome 46 4.161 2.1
Joubert syndrome 66 3.907 2.0
Nephronophthisis 80 3.595 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.500 1.8e-02
ependymoma 1.100 5.5e-07
lung carcinoma 1.700 4.2e-21
ovarian cancer -1.300 3.3e-05

AA Sequence

MELPDPVRQRLGNFSRAVFSDSNRTGPESNEGPENEMVSSLALQMSLYFNTYYFPLWWVSSIMMLHMKYS      1 - 70
ILPDYYKFIVITVIILITLIEAIRLYLGYVGNLQEKVPELAGFWLLSLLLQLPLILFLLFNEGLTNLPLE     71 - 140
KAIHIIFTLFLAFQVVAAFLTLRKMVNQLAVRFHLQDFDRLSANRGDMRRMRSCIEEI                141 - 198
//

Text Mined References (7)

PMID Year Title