Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.06
PubTator Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.500 0.018
posterior fossa group B ependymoma 1.600 0.000
lung carcinoma 1.700 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q86X19 Q53QP7 Q53R98
Symbols

Gene

AA Sequence

MELPDPVRQRLGNFSRAVFSDSNRTGPESNEGPENEMVSSLALQMSLYFNTYYFPLWWVSSIMMLHMKYS      1 - 70
ILPDYYKFIVITVIILITLIEAIRLYLGYVGNLQEKVPELAGFWLLSLLLQLPLILFLLFNEGLTNLPLE     71 - 140
KAIHIIFTLFLAFQVVAAFLTLRKMVNQLAVRFHLQDFDRLSANRGDMRRMRSCIEEI                141 - 198
//

Publication (7)

PMID Year Title
26982032 2016 MKS5 and CEP290 Dependent Assembly Pathway of the Ciliary Transition Zone.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.