Property Summary

NCBI Gene PubMed Count 2
PubMed Score 8.03
PubTator Score 3.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 4.51704476495803E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.74569361427915E-4
posterior fossa group A ependymoma 1511 4.09479719307833E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.38909263196811E-4
lung cancer 4473 5.89038943941337E-4
subependymal giant cell astrocytoma 2287 0.00494818101574552
active ulcerative colitis 477 0.0239309381750091
esophageal adenocarcinoma 737 0.038638307585141

Expression

Synonym

Accession Q86X02 B4DFA7 Q15175
Symbols HUMPPA

Gene

  Ortholog (12)

 Compartment GO Term (1)

AA Sequence

MRRAAGMEDFSAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQQMYSTNEEQVQEIEYLTKQL      1 - 70
DTLRHVNEQHAKVYEQLDLTARDLELTNHRLVLESKAAQQKIHGLTETIERLQAQVEELQAQVEQLRGLE     71 - 140
QLRVLREKRERRRTIHTFPCLKELCTSPRCKDAFRLHSSSLELGPRPLEQENERLQTLVGALRSQVSQER    141 - 210
QRKERAEREYTAVLQEYSELERQLCEMEACRLRVQELEAELLELQQMKQAKTYLLGPDDHLAEALLAPLT    211 - 280
QAPEADDPQPGRGDDLGAQDGVSSPAASPGHVVRKSCSDTALNAIVAKDPASRHAGNLTLHANSVRKRGM    281 - 350
SILREVDEQYHALLEKYEELLSKCRQHGAGVRHAGVQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQ    351 - 420
HVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSSK                             421 - 465
//

Text Mined References (6)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.