Property Summary

NCBI Gene PubMed Count 2
PubMed Score 8.03
PubTator Score 3.17

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86X02 B4DFA7 Q15175
Symbols HUMPPA

Gene

 Compartment GO Term (0)

AA Sequence

MRRAAGMEDFSAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQQMYSTNEEQVQEIEYLTKQL      1 - 70
DTLRHVNEQHAKVYEQLDLTARDLELTNHRLVLESKAAQQKIHGLTETIERLQAQVEELQAQVEQLRGLE     71 - 140
QLRVLREKRERRRTIHTFPCLKELCTSPRCKDAFRLHSSSLELGPRPLEQENERLQTLVGALRSQVSQER    141 - 210
QRKERAEREYTAVLQEYSELERQLCEMEACRLRVQELEAELLELQQMKQAKTYLLGPDDHLAEALLAPLT    211 - 280
QAPEADDPQPGRGDDLGAQDGVSSPAASPGHVVRKSCSDTALNAIVAKDPASRHAGNLTLHANSVRKRGM    281 - 350
SILREVDEQYHALLEKYEELLSKCRQHGAGVRHAGVQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQ    351 - 420
HVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSSK                             421 - 465
//

Text Mined References (6)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.